Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.92
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.023 4.3e-02
astrocytic glioma -1.500 1.9e-02
ependymoma -2.300 1.1e-14
osteosarcoma 1.272 5.9e-05
glioblastoma -1.700 4.5e-06
group 4 medulloblastoma -2.000 8.7e-08
atypical teratoid / rhabdoid tumor -1.600 6.7e-05
medulloblastoma, large-cell -1.500 2.1e-04
juvenile dermatomyositis 1.237 6.3e-12
adult high grade glioma -1.700 1.2e-06
pilocytic astrocytoma -1.300 2.9e-06
ovarian cancer 2.600 1.9e-06
dermatomyositis 1.200 1.7e-03

 GO Process (1)

Protein-protein Interaction (4)

Gene RIF (5)

PMID Text
24672025 NTPDASE4 gene products cooperate with the adenovirus E4orf4 protein through PP2A-dependent and -independent mechanisms and contribute to induction of cell death.
20537721 The present study fails to provide evidence for the contribution of ENTPD4 genes to the etiology of schizophrenia in the Japanese population.
20537721 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15200686 The VSFASSQQ motif confers calcium sensitivity to LALP70 during UDP cleavage.

AA Sequence

MGRIGISCLFPASWHFSISPVGCPRILNTNLRQIMVISVLAAAVSLLYFSVVIIRNKYGRLTRDKKFQRY      1 - 70
LARVTDIEATDTNNPNVNYGIVVDCGSSGSRVFVYCWPRHNGNPHDLLDIRQMRDKNRKPVVMKIKPGIS     71 - 140
EFATSPEKVSDYISPLLNFAAEHVPRAKHKETPLYILCTAGMRILPESQQKAILEDLLTDIPVHFDFLFS    141 - 210
DSHAEVISGKQEGVYAWIGINFVLGRFEHIEDDDEAVVEVNIPGSESSEAIVRKRTAGILDMGGVSTQIA    211 - 280
YEVPKTVSFASSQQEEVAKNLLAEFNLGCDVHQTEHVYRVYVATFLGFGGNAARQRYEDRIFANTIQKNR    281 - 350
LLGKQTGLTPDMPYLDPCLPLDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPP    351 - 420
IHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILRERFDRGLYASHADLHRLKYQC    421 - 490
FKSAWMFEVFHRGFSFPVNYKSLKTALQVYDKEVQWTLGAILYRTRFLPLRDIQQEAFRASHTHWRGVSF    491 - 560
VYNHYLFSGCFLVVLLAILLYLLRLRRIHRRTPRSSSAAALWMEEGLPAQNAPGTL                  561 - 616
//

Text Mined References (14)

PMID Year Title
24672025 2014 NTPDASE4 gene products cooperate with the adenovirus E4orf4 protein through PP2A-dependent and -independent mechanisms and contribute to induction of cell death.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20537721 2011 An association study on polymorphisms in the PEA15, ENTPD4, and GAS2L1 genes and schizophrenia.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15200686 2004 The VSFASSQQ motif confers calcium sensitivity to the intracellular apyrase LALP70.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10858452 2000 First apyrase splice variants have different enzymatic properties.
10393803 1999 A human intracellular apyrase-like protein, LALP70, localizes to lysosomal/autophagic vacuoles.
9556635 1998 Golgi localization and functional expression of human uridine diphosphatase.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.