Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 245.82
PubTator Score 28.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.067 4.3e-02
ovarian cancer -1.100 8.0e-07
posterior fossa group B ependymoma 1.500 7.2e-05

Gene RIF (6)

AA Sequence

MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVG      1 - 70
QHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVL     71 - 140
MAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQIT    141 - 210
FETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVY    211 - 280
QSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFY    281 - 350
TVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAF    351 - 420
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAK    421 - 490
LPSTI                                                                     491 - 495
//

Text Mined References (16)

PMID Year Title