Property Summary

Ligand Count 2
NCBI Gene PubMed Count 109
PubMed Score 518.79
PubTator Score 299.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0
Disease Target Count Z-score Confidence
Thalassemia 53 4.347 2.2
Cancer 2499 3.679 1.8
Vascular disease 319 3.493 1.7

Expression

  Differential Expression (22)

Gene RIF (91)

AA Sequence

MEDTKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAE      1 - 70
KENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIPRSQHQETPVYLGATAGMRLLRME     71 - 140
SEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFG    141 - 210
ALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVASNEILRD    211 - 280
PCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFL    281 - 350
PPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYIL    351 - 420
SLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTYVFLMVLFSLVLFT    421 - 490
VAIIGLLIFHKPSYFWKDMV                                                      491 - 510
//

Text Mined References (112)

PMID Year Title