Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.31
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
gastric cancer 1.800 6.0e-03
hepatocellular carcinoma 1.500 2.3e-03
ependymoma -1.500 4.9e-02
oligodendroglioma -2.000 5.0e-02
astrocytoma -1.300 2.1e-05
glioblastoma -1.800 8.7e-03
medulloblastoma -3.400 2.2e-07
cystic fibrosis 1.798 4.2e-04
atypical teratoid / rhabdoid tumor -3.900 8.2e-10
medulloblastoma, large-cell -4.200 4.8e-06
primitive neuroectodermal tumor -3.800 3.8e-06
tuberculosis 1.500 1.1e-02
intraductal papillary-mucinous carcinoma... -2.900 8.1e-04
active Crohn's disease 1.267 6.9e-03
interstitial cystitis -1.700 1.1e-02
pediatric high grade glioma -1.100 4.8e-02
psoriasis -1.800 8.9e-66
nasopharyngeal carcinoma -1.300 1.7e-02
lung carcinoma 1.600 1.2e-13
Alzheimer's disease -1.600 2.7e-02
Pick disease -2.000 5.6e-04
ductal carcinoma in situ 2.500 6.1e-03
ovarian cancer -1.800 4.6e-05
chronic rhinosinusitis -1.956 4.1e-02
type I diabetes mellitus -1.063 1.9e-02

AA Sequence

MTSKFLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFIT      1 - 70
KTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNIYDSKFWEEATPIWITNQRAGHTSGAAMWP     71 - 140
GTDVKIHKRFPTHYMPYNESVSFEDRVAKIIEWFTSKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISD    141 - 210
IDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFD    211 - 280
EVYEALTHAHPNLTVYKKEDVPERWHYKYNSRIQPIIAVADEGWHILQNKSDDFLLGNHGYDNALADMHP    281 - 350
IFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSV    351 - 420
KPAEYDQEGSYPYFIGVSLGSIIVIVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA                 421 - 477
//

Text Mined References (6)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027689 2001 Structural and catalytic similarities between nucleotide pyrophosphatases/phosphodiesterases and alkaline phosphatases.