Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.14
PubTator Score 4.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -1.400 3.0e-07
glioblastoma multiforme -1.200 2.4e-07
osteosarcoma -1.442 2.3e-02
group 3 medulloblastoma -2.600 5.0e-04
astrocytoma -1.600 1.5e-02
atypical teratoid / rhabdoid tumor -1.900 1.1e-04
medulloblastoma, large-cell -2.100 1.2e-05
primitive neuroectodermal tumor -1.300 2.3e-03
hereditary spastic paraplegia -1.166 5.5e-03
Atopic dermatitis -1.100 2.4e-03
non-small cell lung cancer -1.847 5.4e-14
lung cancer -1.700 1.4e-04
adult high grade glioma -1.500 5.6e-03
nasopharyngeal carcinoma -1.300 1.0e-02
spina bifida -1.256 3.6e-02
Pick disease -1.400 8.6e-03
progressive supranuclear palsy -1.600 1.2e-02
ovarian cancer 1.700 1.2e-03
Down syndrome 1.100 6.4e-03

Gene RIF (2)

PMID Text
24338010 The combined studies expand our understanding of NPP1 and NPP4 substrate specificity and range and provide a rational mechanism by which polymorphisms in NPP1 confer stroke resistance.
22995898 NPP4 promotes hemostasis in vivo by augmenting ADP-mediated platelet aggregation at the site of vascular injury.

AA Sequence

MKLLVILLFSGLITGFRSDSSSSLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKT      1 - 70
FPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTD     71 - 140
VPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKI    141 - 210
DDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILPKINRTEV    211 - 280
YNKLKNCSPHMNVYLKEDIPNRFYYQHNDRIQPIILVADEGWTIVLNESSQKLGDHGYDNSLPSMHPFLA    281 - 350
AHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQWCINLPEAIAIVIGSLLVLTM    351 - 420
LTCLIIIMQNRLSVPRPFSRLQLQEDDDDPLIG                                         421 - 453
//

Text Mined References (11)

PMID Year Title
24338010 2014 Molecular basis of purinergic signal metabolism by ectonucleotide pyrophosphatase/phosphodiesterases 4 and 1 and implications in stroke.
22995898 2012 NPP4 is a procoagulant enzyme on the surface of vascular endothelium.
19946888 2010 Defining the membrane proteome of NK cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027689 2001 Structural and catalytic similarities between nucleotide pyrophosphatases/phosphodiesterases and alkaline phosphatases.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.