Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.42
PubTator Score 55.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.5e-07
tuberculosis 1563 4.4e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.080 2.5e-07
tuberculosis 1.400 4.4e-06

Gene RIF (11)

PMID Text
24906676 The findings support a role for arNOX as a major source of oxidative damage leading to cross-linking of skin proteins.
22659163 The results suggest that phosphorylation of serine-504 by PKCdelta modulates the biological function of tNOX.
21625959 this result suggests that hnRNP F directs formation of the exon 4 minus variant of ENOX2.
21571040 increased NADH levels resulting from ENOX2 inhibition result in decreased prosurvival sphingosine-1-phosphate and increased proapoptotic ceramide, both of which may be important to initiation of the ENOX2 inhibitor-induced apoptotic cascade.
20922471 ENOX2 is a dimeric protein containing 4 coppers/dimer capable of carrying out concerted four electron transfers from NADH or ubiquinol to molecular oxygen as required to form water.
20345278 arNOX activity correlates with age and reaches a maximum at about age 65 in males and 55 in females.
19734125 Enhanced arNOX activity correlates with age and with oxidative changes contributing to skin aging.
18789934 These results indicate that tNOX is suppressed during apoptosis and demonstrate that tNOX down-regulation sensitizes cells to stress-induced growth reduction, suggesting that tNOX is required for transformed cell growth.
18351130 A relationship of tNOX to unregulated growth of cancer cells was provided by data where growth of HeLa cells was inhibited by transfection with the exon 5 antisense oligonucleotides
18023414 results indicate that shRNA targeting of tNOX inhibits the growth of cervical cancer cells, and reduces cell migration via a decrease in the membrane association of Rac.
15706060 tNOX is both necessary and sufficient for the cellular anticancer activities attributed to both EGCg and capsaicin. *tNOX enzyme

AA Sequence

MQRDFRWLWVYEIGYAADNSRTLNVDSTAMTLPMSDPTAWATAMNNLGMAPLGIAGQPILPDFDPALGMM      1 - 70
TGIPPITPMMPGLGIVPPPIPPDMPVVKEIIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGT     71 - 140
EQIIVEVFEQCGEIIAIRKSKKNFCHIRFAEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDD    141 - 210
LYEWECKQRMLAREERHRRRMEEERLRPPSPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGE    211 - 280
VNRRSANNFYSMIQSANSHVRRLVNEKAAHEKDMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDH    281 - 350
FTKAQRKNISVWCKQAEEIRNIHNDELMGIRREEEMEMSDDEIEEMTETKETEESALVSQAEALKEENDS    351 - 420
LRWQLDAYRNEVELLKQEQGKVHREDDPNKEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELEKLKDDKL    421 - 490
QVEKMLENLKEKESCASRLCASNQDSEYPLEKTMNSSPIKSEREALLVGIISTFLHVHPFGASIEYICSY    491 - 560
LHRLDNKICTSDVECLMGRLQHTFKQEMTGVGASLEKRWKFCGFEGLKLT                        561 - 610
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24906676 2014 Age-related NADH oxidase (arNOX)-catalyzed oxidative damage to skin proteins.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22659163 2012 Phosphorylation of serine-504 of tNOX (ENOX2) modulates cell proliferation and migration in cancer cells.
21625959 2011 hnRNP F directs formation of an exon 4 minus variant of tumor-associated NADH oxidase (ENOX2).
21571040 2011 Metabolite modulation of HeLa cell response to ENOX2 inhibitors EGCG and phenoxodiol.
20922471 2010 Essential role of copper in the activity and regular periodicity of a recombinant, tumor-associated, cell surface, growth-related and time-keeping hydroquinone (NADH) oxidase with protein disulfide-thiol interchange activity (ENOX2).
20345278 arNOX: generator of reactive oxygen species in the skin and sera of aging individuals subject to external modulation.
19734125 2008 Age-related ENOX protein (arNOX) activity correlated with oxidative skin damage in the elderly.
18789934 2008 Stress-induced down-regulation of tumor-associated NADH oxidase during apoptosis in transformed cells.
18351130 2007 Antisense experiments demonstrate an exon 4 minus splice variant mRNA as the basis for expression of tNOX, a cancer-specific cell surface protein.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023414 2008 RNA interference targeting tNOX attenuates cell migration via a mechanism that involves membrane association of Rac.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15706060 2004 tNOX is both necessary and sufficient as a cellular target for the anticancer actions of capsaicin and the green tea catechin (-)-epigallocatechin-3-gallate.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356293 2002 Biochemical basis for the biological clock.
11941450 2002 Monoclonal antibody to a cancer-specific and drug-responsive hydroquinone (NADH) oxidase from the sera of cancer patients.
11888291 2002 Molecular cloning and characterization of a tumor-associated, growth-related, and time-keeping hydroquinone (NADH) oxidase (tNOX) of the HeLa cell surface.
11825610 2002 A site-directed mutagenesis analysis of tNOX functional domains.
11488599 2001 Surface NADH oxidase of HeLa cells lacks intrinsic membrane binding motifs.
11437345 2001 Isolation and characterization of a tumor-associated NADH oxidase (tNOX) from the HeLa cell surface.
11412089 2001 Cancer isoform of a tumor-associated cell surface NADH oxidase (tNOX) has properties of a prion.
10354495 1999 The plasma membrane NADH oxidase of HeLa cells has hydroquinone oxidase activity.
9932650 1998 The sulfonylurea-inhibited NADH oxidase activity of HeLa cell plasma membranes has properties of a protein disulfide-thiol oxidoreductase with protein disulfide-thiol interchange activity.
9046026 1997 Inhibition of plasma membrane NADH oxidase activity and growth of HeLa cells by natural and synthetic retinoids.
8150545 1994 Molecular cloning and expression of a cDNA encoding a protein detected by the K1 antibody from an ovarian carcinoma (OVCAR-3) cell line.
1888291 1991 [Mitral valve aneurysm associated with mitral insufficiency in absence of aortic insufficiency].