Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.83
PubTator Score 8.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25677901 The suitability of the present method for gastric serum proteomic analysis was demonstrated and led to the identification of two peptide regions the expression of the SERPINA1 and ENOSF1
24697329 A reverse thymidylate synthase gamma is an l-fuconate dehydratase and its high-resolution crystal structure was determined.
24647007 The toxicity polymorphism in the TYMS region may actually act through ENOSF1
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20458436 Observational study of gene-disease association. (HuGE Navigator)
19190136 Observational study of gene-disease association. (HuGE Navigator)
18635682 Observational study of gene-disease association. (HuGE Navigator)
18427977 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIKGCGITFTLGKGTEVVVCAVN      1 - 70
ALAHHVLNKDLKDIVGDFRGFYRQLTSDGQLRWIGPEKGVVHLATAAVLNAVWDLWAKQEGKPVWKLLVD     71 - 140
MDPRMLVSCIDFRYITDVLTEEDALEILQKGQIGKKEREKQMLAQGYPAYTTSCAWLGYSDDTLKQLCAQ    141 - 210
ALKDGWTRFKVKVGADLQDDMRRCQIIRDMIGPEKTLMMDANQRWDVPEAVEWMSKLAKFKPLWIEEPTS    211 - 280
PDDILGHATISKALVPLGIGIATGEQCHNRVIFKQLLQAKALQFLQIDSCRLGSVNENLSVLLMAKKFEI    281 - 350
PVCPHAGGVGLCELVQHLIIFDYISVSASLENRVCEYVDHLHEHFKYPVMIQRASYMPPKDPGYSTEMKE    351 - 420
ESVKKHQYPDGEVWKKLLPAQEN                                                   421 - 443
//

Text Mined References (25)

PMID Year Title
25677901 2015 Identification of peptide regions of SERPINA1 and ENOSF1 and their protein expression as potential serum biomarkers for gastric cancer.
24697329 2014 Enzymatic and structural characterization of rTS? provides insights into the function of rTS?.
24647007 2015 A candidate gene study of capecitabine-related toxicity in colorectal cancer identifies new toxicity variants at DPYD and a putative role for ENOSF1 rather than TYMS.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20458436 2010 Early-onset ischaemic stroke: analysis of 58 polymorphisms in 17 genes involved in methionine metabolism.
19190136 2009 Association of thymidylate synthase gene with endometrial cancer risk in a Chinese population.
18635682 2008 Genetic analysis of 56 polymorphisms in 17 genes involved in methionine metabolism in patients with abdominal aortic aneurysm.
18427977 2008 High-throughput multiplex single-nucleotide polymorphism (SNP) analysis in genes involved in methionine metabolism.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16162288 2005 Comparative genomic analysis reveals a novel mitochondrial isoform of human rTS protein and unusual phylogenetic distribution of the rTS gene.
15994970 2005 Enhancement of 5-fluorouracil sensitivity by an rTS signaling mimic in H630 colon cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14508106 A novel function for the rTS gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084460 2002 Natural antisense (rTSalpha) RNA induces site-specific cleavage of thymidylate synthase mRNA.
9381988 1997 Recent advances in the study of rTS proteins. rTS expression during growth and in response to thymidylate synthase inhibitors in human tumor cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8869746 1996 rTS gene expression is associated with altered cell sensitivity to thymidylate synthase inhibitors.
8764108 1996 Alternate splicing of the rTS gene product and its overexpression in a 5-fluorouracil-resistant cell line.
8493092 1993 Cloning and characterization of a naturally occurring antisense RNA to human thymidylate synthase mRNA.