Property Summary

NCBI Gene PubMed Count 147
PubMed Score 4530.85
PubTator Score 2505.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (21)

Disease log2 FC p
subependymal giant cell astrocytoma -2.627 3.3e-02
adult high grade glioma -1.700 3.1e-04
astrocytic glioma -1.900 1.1e-03
Astrocytoma, Pilocytic -1.900 2.5e-08
atypical teratoid / rhabdoid tumor -1.600 6.6e-05
colon cancer -2.100 4.9e-02
ependymoma -2.100 9.1e-03
glioblastoma -1.300 2.4e-05
intraductal papillary-mucinous neoplasm ... 2.300 3.4e-04
invasive ductal carcinoma 1.100 1.5e-02
lung carcinoma 2.200 2.3e-33
malignant mesothelioma 1.100 3.5e-06
oligodendroglioma -1.100 7.4e-13
ovarian cancer 1.200 1.9e-02
pancreatic cancer 1.500 8.7e-05
Pick disease -1.600 2.8e-03
pituitary cancer 1.800 1.2e-07
primary pancreatic ductal adenocarcinoma 1.719 3.2e-02
primitive neuroectodermal tumor -1.200 1.6e-02
psoriasis -1.800 1.2e-09
sonic hedgehog group medulloblastoma -1.400 2.2e-03

Protein-protein Interaction (2)

PDB (15)

Gene RIF (123)

AA Sequence

MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN      1 - 70
STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN     71 - 140
SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE    141 - 210
GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY    211 - 280
QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV    281 - 350
TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE    351 - 420
ARFAGHNFRNPSVL                                                            421 - 434
//

Text Mined References (152)

PMID Year Title