Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.68
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Situs Inversus 65 4.037 2.0
Eclampsia 6 3.643 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.100 8.4e-03
ependymoma 2.000 1.2e-02
group 3 medulloblastoma -1.500 5.4e-03
lung adenocarcinoma -1.400 4.2e-06
nasopharyngeal carcinoma -1.600 2.1e-06
pancreatic cancer 1.100 2.4e-04
pancreatic carcinoma 1.100 2.4e-04
psoriasis 4.800 1.9e-138

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEK      1 - 70
TLPPKKNFDRNVPKKPAVPLKTDHPVMGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSG     71 - 140
LVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKE    141 - 210
FQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIANNA                            211 - 256
//

Text Mined References (6)

PMID Year Title