Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 4.6e-03
ependymoma 2.000 1.6e-03
group 3 medulloblastoma 1.200 1.6e-02
intraductal papillary-mucinous adenoma (... -1.500 4.6e-03
intraductal papillary-mucinous carcinoma... -1.600 7.0e-03
nasopharyngeal carcinoma -1.100 1.0e-04
oligodendroglioma 1.300 9.4e-03
osteosarcoma -1.582 4.1e-04
ovarian cancer -1.600 1.9e-09
pancreatic cancer -1.400 1.1e-02
primary pancreatic ductal adenocarcinoma -1.233 3.8e-03

AA Sequence

MCEGPSRISGPIPPDPTLCPDNYRRPTSAQGRLEGNALKLDLLTSDRALDTTAPRGPCIGPGAGEILERG      1 - 70
QRGVGDVLLQLEGISLGPGASLKRKDPKDHEKENLRRIREIQKRFREQERSREQGQPRPLKALWRSPKYD     71 - 140
KVESRVKAQLQEPGPASGTESAHFLRAHSRCGPGLPPPHVSSPQPTPPGPEAKEPGLGVDFIRHNARAAK    141 - 210
RAPRRHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMP    211 - 280
ENQRLETLTKLLQSQSQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMDD        281 - 346
//

Text Mined References (16)

PMID Year Title