Property Summary

NCBI Gene PubMed Count 26
PubMed Score 76.98
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.300 1.6e-05
Astrocytoma, Pilocytic -1.400 2.3e-04
atypical teratoid / rhabdoid tumor -2.200 6.0e-05
ependymoma -1.600 2.0e-04
glioblastoma -2.200 7.3e-07
group 3 medulloblastoma -2.200 8.0e-04
medulloblastoma, large-cell -3.500 7.5e-08
osteosarcoma 1.136 1.9e-02
primitive neuroectodermal tumor -1.800 3.8e-03
psoriasis -2.100 1.2e-66
subependymal giant cell astrocytoma -1.065 1.6e-02

Gene RIF (26)

AA Sequence

MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG      1 - 70
SYLLQP                                                                     71 - 76
//

Text Mined References (27)

PMID Year Title