Property Summary

NCBI Gene PubMed Count 20
PubMed Score 65.02
PubTator Score 12.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 1.136 1.9e-02
ependymoma -1.600 2.0e-04
glioblastoma -2.200 7.3e-07
sonic hedgehog group medulloblastoma -2.600 6.4e-08
atypical teratoid/rhabdoid tumor -2.300 1.3e-06
medulloblastoma, large-cell -3.500 7.5e-08
primitive neuroectodermal tumor -1.800 3.8e-03
adult high grade glioma -2.300 1.6e-05
pilocytic astrocytoma -1.400 2.4e-04
subependymal giant cell astrocytoma -1.065 1.6e-02
psoriasis -2.100 1.2e-66

Synonym

Accession Q6UWT2 Q8N666
Symbols UNQ470
C9orf165

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (20)

PMID Text
26435060 Lipids originating either from the diet or from endogenous production appear to positively affect plasma adropin concentrations in humans.
26371163 Serum adropin level was negatively correlated with carotid beta-stiffness and positively correlated with plasma NOx level and cardiorespiratory fitness
26226125 The adropin levels of metabolic syndrome, obesity, and control groups also showed no difference
26172926 Circulating adropin levels were determined lower in patients with endometrial cancer than in a control group.
26030787 Serum adropin levels were significantly lower in obese children; however, there was no correlation between serum adropin levels and blood pressure variables.
25913544 Adropin as a novel energy factor likely has the ability to regulate blood pressure
25282140 Adropin levels are lower in patients with late saphenous vein graft occlusion and these reduced adropin levels, together with other factors, may lead to saphenous vein graft occlusion
24848071 Release of adropin in the fed condition regulates fuel selection in skeletal muscle, promoting glucose oxidation over fat oxidation. The molecular mechanisms of adropin's effects involve acetylation (suggesting inhibition) of the transcriptional co-activator PGC1alpha, reducing PDK4 and CPT1B activity. Increased PGC1alpha acetylation by adropin may be mediated by inhibiting Sirtuin-1 (SIRT1), a PGC1alpha deacetylase.
24731968 decreased serum adropin levels are associated with the presence of acute myocardial infarction in coronary artery disease patients
24468600 Assessment of serum adropin concentrations may provide a reliable indicator of fatty liver disease in obese adolescents
24284417 cord blood adropin levels were positively correlated with gestational age and placental weight but not with other fetal growth parameters.
24113736 Plasma adropin levels were found to be a new marker for diagnosing endothelial dysfunction in type 2 diabetes mellitus.
23356444 Adropin is an independent risk factor for cardiac syndrome X (CSX).
23314506 The mean maternal and cord serum adropin in a gestational diabetes mellitus group were significantly lower than those of control women (P=0.01 and P<0.001, respectively).
22872690 Although males exhibit higher adropin levels that are reduced by obesity, aging and markers of insulin resistance are associated with low plasma adropin irrespective of sex.
22872690 Plasma adropin levels were examined in 45 men and 85 woman. Adropin levels are higher in men than woman. Obesity is associated with low adropin levels in men. Aging and metabolic risk factors are associated with low adropin levels, irrespective of sex.
22318315 Plasma adropin levels are regulated dietary macronutrients increasing with dietary fat content. Fasting suppresses plasma adropin. Adropin's actions are required for preventing insulin resistance, dyslipidemia and impaired glucose tolerance.
20837912 a potential endothelial protective role of adropin that is likely mediated via upregulation of endothelial NO synthase expression through the VEGFR2-phosphatidylinositol 3-kinase-Akt and VEGFR2-extracellular signal regulated kinase 1/2 pathways.
20837912 Adropin has an endothelial protective function mediated via upregulation of eNOS expression through the VEGFR2-PI3K-Akt and VEGFR2-ERK1/2 pathways. Adropin therapy may thus be useful for limiting diseases characterized by endothelial dysfunction.
19041763 Adropin is the name given to the secreted peptide encoded by the ORF in C9orf165. In mice, it is abundant in liver where it is regulated by dietary macronutrients. Adropin regulates expression of genes involved in lipogenesis and adipogenesis.

AA Sequence

MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEG      1 - 70
SYLLQP                                                                     71 - 76
//

Text Mined References (21)

PMID Year Title
26435060 2015 Differential Responses of Plasma Adropin Concentrations To Dietary Glucose or Fructose Consumption In Humans.
26371163 2015 Aerobic exercise training-induced changes in serum adropin level are associated with reduced arterial stiffness in middle-aged and older adults.
26226125 2015 Are obesity and metabolic syndrome associated with plasma adropin levels in children?
26172926 2015 Circulating adropin levels in patients with endometrium cancer.
26030787 2015 Evaluation of the relationship between serum adropin levels and blood pressure in obese children.
25913544 2015 Adropin as a novel energy factor likely has the ability to regulate blood pressure.
25282140 2014 Adropin: a new marker for predicting late saphenous vein graft disease after coronary artery bypass grafting.
24848071 2014 Regulation of substrate oxidation preferences in muscle by the peptide hormone adropin.
24731968 2014 Serum adropin levels are decreased in patients with acute myocardial infarction.
24468600 2014 Investigation of adropin and leptin levels in pediatric obesity-related nonalcoholic fatty liver disease.
24284417 2014 Relationship between human cord blood adropin levels and fetal growth.
24113736 2013 Plasma adropin levels predict endothelial dysfunction like flow-mediated dilatation in patients with type 2 diabetes mellitus.
23356444 2013 Deficiency of a new protein associated with cardiac syndrome X; called adropin.
23314506 2013 Maternal and fetal adropin levels in gestational diabetes mellitus.
22872690 2012 Low circulating adropin concentrations with obesity and aging correlate with risk factors for metabolic disease and increase after gastric bypass surgery in humans.
22318315 2012 Adropin deficiency is associated with increased adiposity and insulin resistance.
20837912 2010 Adropin is a novel regulator of endothelial function.
19041763 2008 Identification of adropin as a secreted factor linking dietary macronutrient intake with energy homeostasis and lipid metabolism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.