Property Summary

NCBI Gene PubMed Count 13
PubMed Score 182.61
PubTator Score 39.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.186 6.7e-05

Gene RIF (8)

AA Sequence

MALEAAGGPPEETLSLWKREQARLKAHVVDRDTEAWQRDPAFSGLQRVGGVDVSFVKGDSVRACASLVVL      1 - 70
SFPELEVVYEESRMVSLTAPYVSGFLAFREVPFLLELVQQLREKEPGLMPQVLLVDGNGVLHHRGFGVAC     71 - 140
HLGVLTDLPCVGVAKKLLQVDGLENNALHKEKIRLLQTRGDSFPLLGDSGTVLGMALRSHDRSTRPLYIS    141 - 210
VGHRMSLEAAVRLTCCCCRFRIPEPVRQADICSREHIRKSLGLPGPPTPRSPKAQRPVACPKGDSGESSA    211 - 280
LC                                                                        281 - 282
//

Text Mined References (16)

PMID Year Title