Property Summary

NCBI Gene PubMed Count 37
PubMed Score 158.46
PubTator Score 109.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 3.817 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.505 2.0e-04
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
non primary Sjogren syndrome sicca 1.100 2.9e-02
ovarian cancer 1.700 2.6e-05

Gene RIF (30)

PMID Text
27239850 These findings suggest that non-viral DNA vectors are also substrates for EndoG in its role in homologous recombination
26492643 our study established a link between Endo G and mitochondrial function during cardiac hypertrophy
25436615 Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG.
25401220 Data suggest that endonuclease G (EndoG) inhibitors have the potential to be utilized for amelioration of cell injuries in which participation of EndoG is essential.
25139236 study demonstrate EndoG interacts with cellular Inhibitor of Apoptosis Protein 1 (cIAP1); results indicate IAPs interact and ubiquitinate EndoG via K63-mediated isopeptide linkages without affecting EndoG levels and EndoG-mediated cell death, suggesting EndoG ubiquitination by IAPs may serve as a regulatory signal independent of proteasomal degradation
25132265 Endonuclease G (EndoG), an apoptotic nuclease, as an essential factor for MLLbcr-specific DNA recombination after induction of replication stress.
24371120 Data indicate that older muscles showed a 3-fold greater fraction of endonuclease G (a mitochondrial proapoptotic factor)-positive myonuclei.
24129513 Endonuclease G mediates alpha-synuclein cytotoxicity during Parkinson's disease.
24038028 Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner.
23986585 These data indicate that HSV-1 UL12.5 deploys cellular proteins, including ENDOG and EXOG, to destroy mtDNA and contribute to a growing body of literature highlighting roles for ENDOG and EXOG in mtDNA maintenance.
23764847 CHIP overexpression reduces EndoG levels, and results in reduced or no oxidative stress-induced cell death in cultured cancer cells.
23109891 Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G.
22160858 Conclude that EndoG and TOPO2a may actively participate in apoptotic chromatin degradation.
22011247 Data show that among the 13 SNPs in the 3 genes, only 3 were found to be polymorphic: R196K and K277R in the DFFB gene, and S12L in the EndoG gene, and all 6 SNPs in the FEN-1 gene were entirely monoallelic.
21206973 Benzyl isothiocyanate induces apoptosis in DU 145 cells through the release of AIF and Endo G from the mitochondria and also promotes caspase-3 activation.
21080888 ENDOG might contribute to cancer pathogenesis by expressional alterations, but not by somatic mutations
20877624 Observational study of gene-disease association. (HuGE Navigator)
20211237 When EndoG gene expression was downregulated by lentiviral shRNA vectors, we found a significant reduction in the replicative life span and a corresponding increase in cell death.
19781850 nuclear translocation of apoptosis-inducing factor and endonuclease G play a crucial role in (-)-Epigallocatechin-3-gallate -induced apoptosis of human laryngeal epidermoid carcinoma Hep2 cells
19272175 Results suggest that human Endonuclease G shares a similar catalytic mechanism with nuclease A from Anabaena.
19199036 These results suggest that Bim, Bcl-xL, FAK and endonuclease G are involved in safingol-induced apoptosis of detached oral squamous cell carcinoma.
18754329 data showed that loss of EndoG expression is a feature of hepatocellular carcinomas
18705403 EndoG inactivation by loss of expression may not occur in colorectal and gastric cancers. Rather, neo-expression of EndoG may play a role in both colorectal and gastric tumorigenesis.
17347867 study of cellular localization of the endonuclease G, AIF & AMID during apoptosis using bioinformatics and image analysis
17107772 Hypochlorous acid induced Bax-dependent mitochondrial permeability which led to cell death without caspase activity by processes involving AIF/EndoG-dependent pathways.
17046751 Our findings suggest that the presence of EndoG in non-invasive breast cancer cells determines their sensitivity to apoptosis, which may be taken into consideration for developing the chemotherapeutic strategy for cancer treatment.
16133872 EndoG forms complexes with AIF and FEN-1 but not with PCNA. Heat shock proteins 70 interact with EndoG and are involved in the regulation of its activity.
15204919 HIV-1 Tat-induced neurotoxicity is associated with the activation of a pathway involving endonuclease G
15182854 endonuclease G and apoptosis-inducing factor are relocated and have roles in calcium induced signaling and oxidative stress-related impairment of mitochondria
12444964 examination of submitochondrial localization and its ability to cleave R-loops in order to clarify role in mtDNA replication

AA Sequence

MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRGPGELAKYGLP      1 - 70
GLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRG     71 - 140
HLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGK    141 - 210
SYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVP    211 - 280
NILARAGSLKAITAGSK                                                         281 - 297
//

Text Mined References (39)

PMID Year Title
27239850 [Effect of endonuclease G depletion on plasmid DNA uptake and levels of homologous recombination in hela cells].
26492643 2015 Characterization of endonuclease G and mitochondria-sarcoplasmic reticulum-related proteins during cardiac hypertrophy.
25436615 2014 The proapoptotic protein BNIP3 interacts with VDAC to induce mitochondrial release of endonuclease G.
25401220 2015 Novel cytoprotective inhibitors for apoptotic endonuclease G.
25139236 2014 Cellular inhibitor of apoptosis protein 1 ubiquitinates endonuclease G but does not affect endonuclease G-mediated cell death.
25132265 2015 Endonuclease G initiates DNA rearrangements at the MLL breakpoint cluster upon replication stress.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24371120 2014 Increased sensitivity to mitochondrial permeability transition and myonuclear translocation of endonuclease G in atrophied muscle of physically active older humans.
24129513 2013 Endonuclease G mediates ?-synuclein cytotoxicity during Parkinson's disease.
24038028 2014 Impact of promoter polymorphisms in key regulators of the intrinsic apoptosis pathway on the outcome of childhood acute lymphoblastic leukemia.
23986585 2013 Mitochondrial nucleases ENDOG and EXOG participate in mitochondrial DNA depletion initiated by herpes simplex virus 1 UL12.5.
23764847 2013 CHIP has a protective role against oxidative stress-induced cell death through specific regulation of endonuclease G.
23109891 2012 Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G.
22160858 2012 Endonuclease G interacts with histone H2B and DNA topoisomerase II alpha during apoptosis.
22011247 2012 Nonsynonymous single-nucleotide polymorphisms of the human apoptosis-related endonuclease--DNA fragmentation factor beta polypeptide, endonuclease G, and Flap endonuclease-1--genes show a low degree of genetic heterogeneity.
21269460 2011 Initial characterization of the human central proteome.
21206973 2011 The roles of AIF and Endo G in the apoptotic effects of benzyl isothiocyanate on DU 145 human prostate cancer cells via the mitochondrial signaling pathway.
21080888 2010 Mutational analysis of pro-apoptotic ENDOG gene in common solid cancers and acute leukaemias.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20843780 2011 Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing.
20211237 2010 Role of endonuclease G in senescence-associated cell death of human endothelial cells.
19781850 2010 EGCG induces apoptosis in human laryngeal epidermoid carcinoma Hep2 cells via mitochondria with the release of apoptosis-inducing factor and endonuclease G.
19272175 2009 Mutagenesis identifies the critical amino acid residues of human endonuclease G involved in catalysis, magnesium coordination, and substrate specificity.
19199036 2009 Induction of apoptosis of detached oral squamous cell carcinoma cells by safingol. Possible role of Bim, focal adhesion kinase and endonuclease G.
18754329 2008 Decreased expression of endonuclease G (EndoG), a pro-apoptotic protein, in hepatocellular carcinomas.
18705403 Increased expression of endonuclease G in gastric and colorectal carcinomas.
18309324 2008 No death without life: vital functions of apoptotic effectors.
17347867 2007 Bioinformatic and image analyses of the cellular localization of the apoptotic proteins endonuclease G, AIF, and AMID during apoptosis in human cells.
17107772 2007 The pro-inflammatory oxidant hypochlorous acid induces Bax-dependent mitochondrial permeabilisation and cell death through AIF-/EndoG-dependent pathways.
17046751 2006 Endonuclease G promotes cell death of non-invasive human breast cancer cells.
16133872 2005 Regulation of the human apoptotic DNase/RNase endonuclease G: involvement of Hsp70 and ATP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15182854 2004 Cadmium induces caspase-independent apoptosis in liver Hep3B cells: role for calcium in signaling oxidative stress-related impairment of mitochondria and relocation of endonuclease G and apoptosis-inducing factor.
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444964 2002 Mammalian mitochondrial endonuclease G. Digestion of R-loops and localization in intermembrane space.
11452314 2001 Endonuclease G is an apoptotic DNase when released from mitochondria.
9324313 1997 Characterization and expression of the mouse endonuclease G gene.
7789991 1995 Chromosomal localization of mitochondrial transcription factor A (TCF6), single-stranded DNA-binding protein (SSBP), and endonuclease G (ENDOG), three human housekeeping genes involved in mitochondrial biogenesis.