| Tchem | Endonuclease G, mitochondrial |
Cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, also has ribonuclease (RNase) and RNase H activities. Capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA (By similarity).
The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| atypical teratoid / rhabdoid tumor | 4369 | 1.1e-05 |
| ovarian cancer | 8491 | 2.6e-05 |
| osteosarcoma | 7933 | 2.0e-04 |
| non primary Sjogren syndrome sicca | 840 | 2.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | -1.505 | 2.0e-04 |
| atypical teratoid / rhabdoid tumor | -1.200 | 1.1e-05 |
| non primary Sjogren syndrome sicca | 1.100 | 2.9e-02 |
| ovarian cancer | 1.700 | 2.6e-05 |
| PMID | Text | |
|---|---|---|
| 27239850 | These findings suggest that non-viral DNA vectors are also substrates for EndoG in its role in homologous recombination | |
| 26492643 | our study established a link between Endo G and mitochondrial function during cardiac hypertrophy | |
| 25436615 | Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG. | |
| 25401220 | Data suggest that endonuclease G (EndoG) inhibitors have the potential to be utilized for amelioration of cell injuries in which participation of EndoG is essential. | |
| 25139236 | study demonstrate EndoG interacts with cellular Inhibitor of Apoptosis Protein 1 (cIAP1); results indicate IAPs interact and ubiquitinate EndoG via K63-mediated isopeptide linkages without affecting EndoG levels and EndoG-mediated cell death, suggesting EndoG ubiquitination by IAPs may serve as a regulatory signal independent of proteasomal degradation | |
| 25132265 | Endonuclease G (EndoG), an apoptotic nuclease, as an essential factor for MLLbcr-specific DNA recombination after induction of replication stress. | |
| 24371120 | Data indicate that older muscles showed a 3-fold greater fraction of endonuclease G (a mitochondrial proapoptotic factor)-positive myonuclei. | |
| 24129513 | Endonuclease G mediates alpha-synuclein cytotoxicity during Parkinson's disease. | |
| 24038028 | Using gene reporter assays, we show that promoter variations in 11 intrinsic apoptosis genes, including ADPRT, APAF1, BCL2, BAD, BID, MCL1, BIRC4, BCL2L1, ENDOG, YWHAB, and YWHAQ, influence promoter activity in an allele-specific manner. | |
| 23986585 | These data indicate that HSV-1 UL12.5 deploys cellular proteins, including ENDOG and EXOG, to destroy mtDNA and contribute to a growing body of literature highlighting roles for ENDOG and EXOG in mtDNA maintenance. | |
| 23764847 | CHIP overexpression reduces EndoG levels, and results in reduced or no oxidative stress-induced cell death in cultured cancer cells. | |
| 23109891 | Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G. | |
| 22160858 | Conclude that EndoG and TOPO2a may actively participate in apoptotic chromatin degradation. | |
| 22011247 | Data show that among the 13 SNPs in the 3 genes, only 3 were found to be polymorphic: R196K and K277R in the DFFB gene, and S12L in the EndoG gene, and all 6 SNPs in the FEN-1 gene were entirely monoallelic. | |
| 21206973 | Benzyl isothiocyanate induces apoptosis in DU 145 cells through the release of AIF and Endo G from the mitochondria and also promotes caspase-3 activation. | |
| 21080888 | ENDOG might contribute to cancer pathogenesis by expressional alterations, but not by somatic mutations | |
| 20877624 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20211237 | When EndoG gene expression was downregulated by lentiviral shRNA vectors, we found a significant reduction in the replicative life span and a corresponding increase in cell death. | |
| 19781850 | nuclear translocation of apoptosis-inducing factor and endonuclease G play a crucial role in (-)-Epigallocatechin-3-gallate -induced apoptosis of human laryngeal epidermoid carcinoma Hep2 cells | |
| 19272175 | Results suggest that human Endonuclease G shares a similar catalytic mechanism with nuclease A from Anabaena. | |
| 19199036 | These results suggest that Bim, Bcl-xL, FAK and endonuclease G are involved in safingol-induced apoptosis of detached oral squamous cell carcinoma. | |
| 18754329 | data showed that loss of EndoG expression is a feature of hepatocellular carcinomas | |
| 18705403 | EndoG inactivation by loss of expression may not occur in colorectal and gastric cancers. Rather, neo-expression of EndoG may play a role in both colorectal and gastric tumorigenesis. | |
| 17347867 | study of cellular localization of the endonuclease G, AIF & AMID during apoptosis using bioinformatics and image analysis | |
| 17107772 | Hypochlorous acid induced Bax-dependent mitochondrial permeability which led to cell death without caspase activity by processes involving AIF/EndoG-dependent pathways. | |
| 17046751 | Our findings suggest that the presence of EndoG in non-invasive breast cancer cells determines their sensitivity to apoptosis, which may be taken into consideration for developing the chemotherapeutic strategy for cancer treatment. | |
| 16133872 | EndoG forms complexes with AIF and FEN-1 but not with PCNA. Heat shock proteins 70 interact with EndoG and are involved in the regulation of its activity. | |
| 15204919 | HIV-1 Tat-induced neurotoxicity is associated with the activation of a pathway involving endonuclease G | |
| 15182854 | endonuclease G and apoptosis-inducing factor are relocated and have roles in calcium induced signaling and oxidative stress-related impairment of mitochondria | |
| 12444964 | examination of submitochondrial localization and its ability to cleave R-loops in order to clarify role in mtDNA replication |
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRGPGELAKYGLP 1 - 70 GLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDSVHAYHRATNADYRGSGFDRG 71 - 140 HLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLEKYSRSLTRSYQNVYVCTGPLFLPRTEADGK 141 - 210 SYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVP 211 - 280 NILARAGSLKAITAGSK 281 - 297 //
| PMID | Year | Title | |
|---|---|---|---|
| 27239850 | [Effect of endonuclease G depletion on plasmid DNA uptake and levels of homologous recombination in hela cells]. | ||
| 26492643 | 2015 | Characterization of endonuclease G and mitochondria-sarcoplasmic reticulum-related proteins during cardiac hypertrophy. | |
| 25436615 | 2014 | The proapoptotic protein BNIP3 interacts with VDAC to induce mitochondrial release of endonuclease G. | |
| 25401220 | 2015 | Novel cytoprotective inhibitors for apoptotic endonuclease G. | |
| 25139236 | 2014 | Cellular inhibitor of apoptosis protein 1 ubiquitinates endonuclease G but does not affect endonuclease G-mediated cell death. | |
| 25132265 | 2015 | Endonuclease G initiates DNA rearrangements at the MLL breakpoint cluster upon replication stress. | |
| 25036637 | 2014 | A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways. | |
| 24371120 | 2014 | Increased sensitivity to mitochondrial permeability transition and myonuclear translocation of endonuclease G in atrophied muscle of physically active older humans. | |
| 24129513 | 2013 | Endonuclease G mediates ?-synuclein cytotoxicity during Parkinson's disease. | |
| 24038028 | 2014 | Impact of promoter polymorphisms in key regulators of the intrinsic apoptosis pathway on the outcome of childhood acute lymphoblastic leukemia. | |
| 23986585 | 2013 | Mitochondrial nucleases ENDOG and EXOG participate in mitochondrial DNA depletion initiated by herpes simplex virus 1 UL12.5. | |
| 23764847 | 2013 | CHIP has a protective role against oxidative stress-induced cell death through specific regulation of endonuclease G. | |
| 23109891 | 2012 | Ethyl gallate induces apoptosis of HL-60 cells by promoting the expression of caspases-8, -9, -3, apoptosis-inducing factor and endonuclease G. | |
| 22160858 | 2012 | Endonuclease G interacts with histone H2B and DNA topoisomerase II alpha during apoptosis. | |
| 22011247 | 2012 | Nonsynonymous single-nucleotide polymorphisms of the human apoptosis-related endonuclease--DNA fragmentation factor beta polypeptide, endonuclease G, and Flap endonuclease-1--genes show a low degree of genetic heterogeneity. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21206973 | 2011 | The roles of AIF and Endo G in the apoptotic effects of benzyl isothiocyanate on DU 145 human prostate cancer cells via the mitochondrial signaling pathway. | |
| 21080888 | 2010 | Mutational analysis of pro-apoptotic ENDOG gene in common solid cancers and acute leukaemias. | |
| 20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. | |
| 20843780 | 2011 | Identification of rare DNA variants in mitochondrial disorders with improved array-based sequencing. | |
| 20211237 | 2010 | Role of endonuclease G in senescence-associated cell death of human endothelial cells. | |
| 19781850 | 2010 | EGCG induces apoptosis in human laryngeal epidermoid carcinoma Hep2 cells via mitochondria with the release of apoptosis-inducing factor and endonuclease G. | |
| 19272175 | 2009 | Mutagenesis identifies the critical amino acid residues of human endonuclease G involved in catalysis, magnesium coordination, and substrate specificity. | |
| 19199036 | 2009 | Induction of apoptosis of detached oral squamous cell carcinoma cells by safingol. Possible role of Bim, focal adhesion kinase and endonuclease G. | |
| 18754329 | 2008 | Decreased expression of endonuclease G (EndoG), a pro-apoptotic protein, in hepatocellular carcinomas. | |
| 18705403 | Increased expression of endonuclease G in gastric and colorectal carcinomas. | ||
| 18309324 | 2008 | No death without life: vital functions of apoptotic effectors. | |
| 17347867 | 2007 | Bioinformatic and image analyses of the cellular localization of the apoptotic proteins endonuclease G, AIF, and AMID during apoptosis in human cells. | |
| 17107772 | 2007 | The pro-inflammatory oxidant hypochlorous acid induces Bax-dependent mitochondrial permeabilisation and cell death through AIF-/EndoG-dependent pathways. | |
| 17046751 | 2006 | Endonuclease G promotes cell death of non-invasive human breast cancer cells. | |
| 16133872 | 2005 | Regulation of the human apoptotic DNase/RNase endonuclease G: involvement of Hsp70 and ATP. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15182854 | 2004 | Cadmium induces caspase-independent apoptosis in liver Hep3B cells: role for calcium in signaling oxidative stress-related impairment of mitochondria and relocation of endonuclease G and apoptosis-inducing factor. | |
| 15164053 | 2004 | DNA sequence and analysis of human chromosome 9. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12444964 | 2002 | Mammalian mitochondrial endonuclease G. Digestion of R-loops and localization in intermembrane space. | |
| 11452314 | 2001 | Endonuclease G is an apoptotic DNase when released from mitochondria. | |
| 9324313 | 1997 | Characterization and expression of the mouse endonuclease G gene. | |
| 7789991 | 1995 | Chromosomal localization of mitochondrial transcription factor A (TCF6), single-stranded DNA-binding protein (SSBP), and endonuclease G (ENDOG), three human housekeeping genes involved in mitochondrial biogenesis. |
