Property Summary

NCBI Gene PubMed Count 69
PubMed Score 9.91
PubTator Score 302.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.022 1.1e-02
astrocytoma 1.300 2.4e-16
Astrocytoma, Pilocytic 1.100 3.7e-04
atypical teratoid / rhabdoid tumor 1.500 3.7e-06
Breast cancer 1.300 4.6e-04
cystic fibrosis -1.276 5.6e-05
ductal carcinoma in situ 1.100 3.7e-02
ependymoma 1.300 5.9e-08
glioblastoma 1.200 4.1e-05
group 3 medulloblastoma 1.700 3.8e-03
hereditary spastic paraplegia -1.580 9.9e-03
interstitial lung disease 1.200 4.5e-02
invasive ductal carcinoma 1.300 6.7e-03
juvenile dermatomyositis 1.070 7.0e-05
lung cancer 1.100 1.4e-02
medulloblastoma, large-cell 1.200 7.6e-05
non-small cell lung cancer 1.304 8.0e-17
oligodendroglioma 1.200 3.7e-12
osteosarcoma 1.363 4.4e-03
ovarian cancer 1.500 1.2e-02
pediatric high grade glioma 1.100 3.3e-03
primitive neuroectodermal tumor 1.100 1.4e-03
subependymal giant cell astrocytoma 1.633 1.1e-02

Gene RIF (35)

AA Sequence

MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKY      1 - 70
NQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEEL     71 - 140
EIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERL    141 - 210
ERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSV    211 - 280
LGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP    281 - 350
PPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIG    351 - 420
VNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTP    421 - 490
EPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQ    491 - 560
DILDEMRKELTKLKEELIDAIRQELSKSNTA                                           561 - 591
//

Text Mined References (77)

PMID Year Title