Property Summary

NCBI Gene PubMed Count 31
PubMed Score 257.47
PubTator Score 58.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.800 8.4e-09
glioblastoma 2.700 2.1e-03
medulloblastoma, large-cell 1.200 1.9e-02
primitive neuroectodermal tumor 1.400 4.5e-02
adult high grade glioma 1.900 1.7e-02
subependymal giant cell astrocytoma 2.465 1.3e-02
Breast cancer 1.600 1.5e-03

 GO Component (1)

Gene RIF (19)

PMID Text
26367794 low-frequency non-coding variant near a novel locus, EN1, with an effect on bone mineral density--which was also associated with a decreased risk of fracture
24685177 The current review describes the role of two such factors, Nurr1 and engrailed, in differentiation, maturation, and in normal physiological functions including acquisition of neurotransmitter identity.
24141779 EN1 is an activator of intrinsic inflammatory pathways associated with prosurvival in basal-like breast cancer.
21800291 EN1 is a biologic predictor of poor prognosis in patients with salivary adenoid cystic carcinoma.
21672318 Homeobox protein engrailed-1 protein regulates transcription of the utrophin gene.
21482524 EN1 might be a negative regulatory factor for UTROPHIN.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19384295 Epigenetic suppression along 2q14.2 is common to most colorectal cancers and the presence of a methylated EN1 CpG island in stool DNA might be used as biomarker of neoplastic disease.
19345444 The result of this study found a strong association between the EN1 rs1438852 polymorphism and Parkinson's disease.
19345444 Observational study of gene-disease association. (HuGE Navigator)
19018235 Observational study of gene-disease association. (HuGE Navigator)
18698228 Single nucleotide polymorphisms genotyped in the EN1 gene were associated with schizophrenia symptoms
18698228 Genetic variation in human engrailed 1 may influence antipsychotic response in schizophrenia.
16730693 When beta-catenin is activated in transgenic En1 expressing cells, it induces Dermo1 expression in all cells of the En1 domain and disrupts muscle gene expression.
16571670 En-1 exerts its repressive effect by a mechanism negatively controlling the level of beta-catenin.
15240857 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEEQQPEPKSQRDSALGAAAAATPGGLSLSLSPGASGSSGSGSDGDSVPVSPQPAPPSPPAAPCLPPLAH      1 - 70
HPHLPPHPPPPPPQHLAAPAHQPQPAAQLHRTTNFFIDNILRPDFGCKKEQPPPQLLVAAAARGGAGGGG     71 - 140
RVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGNPAAAAAAAAAAVA    141 - 210
AAAAAAAAKPSDTGGGGSGGGAGSPGAQGTKYPEHGNPAILLMGSANGGPVVKTDSQQPLVWPAWVYCTR    211 - 280
YSDRPSSGPRTRKLKKKKNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIW    281 - 350
FQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKDESE                                351 - 392
//

Text Mined References (32)

PMID Year Title
26367794 2015 Whole-genome sequencing identifies EN1 as a determinant of bone density and fracture.
24685177 2014 The lifelong maintenance of mesencephalic dopaminergic neurons by Nurr1 and engrailed.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24399192 2014 Differentiation of human epidermal neural crest stem cells (hEPI-NCSC) into virtually homogenous populations of dopaminergic neurons.
24141779 2014 Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function.
21800291 2012 Developmental transcription factor EN1--a novel biomarker in human salivary gland adenoid cystic carcinoma.
21672318 2011 A method of utrophin up-regulation through RNAi-mediated knockdown of the transcription factor EN1.
21482524 2011 [The regulation of UTROPHIN expression by EN1].
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19384295 2009 Long-range epigenetic silencing at 2q14.2 affects most human colorectal cancers and may have application as a non-invasive biomarker of disease.
19345444 2011 Association of transcription factor polymorphisms PITX3 and EN1 with Parkinson's disease.
19018235 2008 Polymorphisms of coding trinucleotide repeats of homeogenes in neurodevelopmental psychiatric disorders.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
18698228 2008 Model-based gene selection shows engrailed 1 is associated with antipsychotic response.
16730693 2006 Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse.
16571670 2006 Engrailed-1 negatively regulates beta-catenin transcriptional activity by destabilizing beta-catenin via a glycogen synthase kinase-3beta-independent pathway.
15839736 2005 Differentiation of insulin-producing cells from human neural progenitor cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15240857 2004 Sudden infant death syndrome: case-control frequency differences at genes pertinent to early autonomic nervous system embryologic development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11551904 2001 Functional interaction of Jun and homeodomain proteins.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11069920 2001 Superactivation of Pax6-mediated transactivation from paired domain-binding sites by dna-independent recruitment of different homeodomain proteins.
9169834 1997 Association of Engrailed homeoproteins with vesicles presenting caveolae-like properties.
8684466 1996 The mouse Engrailed-1 gene and ventral limb patterning.
8094370 1993 Regional assignment of the human homeobox-containing gene EN1 to chromosome 2q13-q21.
7777574 1995 Deregulated expression of PAX5 in medulloblastoma.
2567700 1989 Chromosomal localization of the human homeo box-containing genes, EN1 and EN2.
1363401 1992 Cloning and sequence comparison of the mouse, human, and chicken engrailed genes reveal potential functional domains and regulatory regions.