Property Summary

NCBI Gene PubMed Count 35
PubMed Score 107.11
PubTator Score 66.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis -1.234 7.0e-03
astrocytic glioma -2.500 1.2e-02
ependymoma -3.500 3.7e-03
psoriasis -2.100 1.4e-07
cutaneous lupus erythematosus -1.300 2.3e-02
glioblastoma -2.700 2.4e-02
oligodendroglioma -1.300 7.9e-06
osteosarcoma -1.536 2.2e-02
atypical teratoid / rhabdoid tumor -2.400 1.4e-02
medulloblastoma -3.800 3.7e-04
primitive neuroectodermal tumor -3.000 1.5e-02
Atopic dermatitis -1.800 5.9e-04
lung cancer 6.700 1.9e-07
interstitial cystitis -1.800 2.6e-04
pediatric high grade glioma -2.100 2.4e-02
pilocytic astrocytoma -2.800 3.5e-04
Pick disease 1.400 7.4e-03
ductal carcinoma in situ -1.800 5.0e-04
invasive ductal carcinoma -1.800 2.5e-03
ovarian cancer 1.700 2.3e-02
Down syndrome 1.100 2.7e-02

Pathway (1)

Gene RIF (21)

PMID Text
26132438 EMX2 expression was down-regulated in lung SCC tissue compared to matched adjacent normal tissue. EMX2 expression was associated with improved overall survival. Knockdown promoted chemo-resistance and cell migration.
25577462 Although it is uncommon (0.19%), EMX2 is the first gene identified that if perturbed may cause isolated incomplete mullerian fusion.
25023662 EMX2 expression is downregulated in advanced cases of malignant pleural mesothelioma and may serve as an important prognostic and predictive molecular biomarker of progression-free survival.
24975717 Deletions of EMX2 have been associated with a wide range of DSD.
23370654 downregulation of empty spiracles homeobox 2 (EMX2) was associated with tumor progression and may be a critical factor in the carcinogenesis and progression of endometrial cancer
23029345 EMX2 expression led to inhibition of cell proliferation and Wnt signaling pathway both in vitro and in a gastric cancer xenograft model in vivo.
21917011 Study analyzed mutations of EMX2 gene in 45 prostate carcinomas, 51 non-small cell lung cancers, 43 gastric carcinomas, 44 colorectal carcinomas, and 43 breast carcinomas by polymerase chain reaction and single-strand conformation polymorphism assay.
21726823 Downregulation of EMX2 is associated with clinical outcomes in lung adenocarcinoma.
21651764 Data show that human teneurin-1 is directly regulated by EMX2 at a conserved promoter region upstream of the transcription start site, and identify and characterize the EMX2 dependent promoter element of human teneurin-1.
20697358 promoter. Restoration of EMX2 expression in lung cancer cells lacking endogenous EMX2 expression suppressed cell proliferation and invasive phenotypes
20634891 Observational study of gene-disease association. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18973570 These data support recent reports that EMX2 but not PAX6 is more directly involved in arealization, highlighting that analysis of human development allows better spatio-temporal resolution than studies in rodents.
18409201 provide results of EMX2 sequencing in 39 new schizencephaly patients, detecting no pathogenic mutations
17563403 Observational study of gene-disease association. (HuGE Navigator)
17563403 It is unlikely that the EMX2 or PTEN gene variants investigated contribute to risk for initiation and/or development of endometriosis.
17506092 Observational study of genotype prevalence. (HuGE Navigator)
15294144 EMX2 levels in cortical progenitors of EMX2 transgenic mice disproportionately specify sizes and positions of primary cortical areas.
15126568 Endometrial EMX2 expression is aberrant in women with endometriosis and is mediated by altered HOXA10 expression.
12482956 In these studies we identify and characterize the regulation of EMX2 by HOXA10.
12185771 EMX2 gene has been reported in schezencephaly (cleft brain) including epilepsy in some patients.

AA Sequence

MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLV      1 - 70
FAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTS     71 - 140
PESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK    141 - 210
RQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD                                211 - 252
//

Text Mined References (36)

PMID Year Title
26132438 2015 EMX2 Is a Predictive Marker for Adjuvant Chemotherapy in Lung Squamous Cell Carcinomas.
25577462 2015 Nonsense mutation of EMX2 is potential causative for uterus didelphysis: first molecular explanation for isolated incomplete müllerian fusion.
25023662 2014 The homeobox gene EMX2 is a prognostic and predictive marker in malignant pleural mesothelioma.
24975717 2014 Severe sex differentiation disorder in a boy with a 3.8 Mb 10q25.3-q26.12 microdeletion encompassing EMX2.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23370654 2013 EMX2 is downregulated in endometrial cancer and correlated with tumor progression.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23029345 2012 Adenoviral delivery of the EMX2 gene suppresses growth in human gastric cancer.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22683750 2012 A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern.
21917011 2011 Rare somatic mutation and loss of expression of EMX2 gene in common solid cancers.
21726823 2011 Downregulation of EMX2 is associated with clinical outcomes in lung adenocarcinoma patients.
21651764 2011 Human teneurin-1 is a direct target of the homeobox transcription factor EMX2 at a novel alternate promoter.
20697358 2010 EMX2 is epigenetically silenced and suppresses growth in human lung cancer.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
18973570 2008 Progressive loss of PAX6, TBR2, NEUROD and TBR1 mRNA gradients correlates with translocation of EMX2 to the cortical plate during human cortical development.
18409201 2008 No major role for the EMX2 gene in schizencephaly.
17563403 2007 Variants in EMX2 and PTEN do not contribute to risk of endometriosis.
17506092 2007 Comprehensive EMX2 genotyping of a large schizencephaly case series.
15294144 2004 EMX2 regulates sizes and positioning of the primary sensory and motor areas in neocortex by direct specification of cortical progenitors.
15247416 2004 Emx2 homeodomain transcription factor interacts with eukaryotic translation initiation factor 4E (eIF4E) in the axons of olfactory sensory neurons.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15126568 2004 EMX2 gene expression in the female reproductive tract and aberrant expression in the endometrium of patients with endometriosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12573261 2003 Antisense transcripts at the EMX2 locus in human and mouse.
12482956 2003 Transcriptional repression of peri-implantation EMX2 expression in mammalian reproduction by HOXA10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185771 2002 Epileptogenic brain malformations: clinical presentation, malformative patterns and indications for genetic testing.
11549315 2001 Characterization of the homeodomain gene EMX2: sequence conservation, expression analysis, and a search for mutations in endometrial cancers.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
8528262 1996 Germline mutations in the homeobox gene EMX2 in patients with severe schizencephaly.
7959790 1994 Chromosome locations of human EMX and OTX genes.
1352754 1992 Two vertebrate homeobox genes related to the Drosophila empty spiracles gene are expressed in the embryonic cerebral cortex.