Property Summary

NCBI Gene PubMed Count 24
PubMed Score 47.77
PubTator Score 24.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Synonym

Accession P54852 Q6FH01 EMP-3
Symbols YMP

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (15)

AA Sequence

MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLM      1 - 70
VLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFA     71 - 140
LAWVAFPLALVSGIIYIHLRKRE                                                   141 - 163
//

Text Mined References (24)

PMID Year Title