Property Summary

NCBI Gene PubMed Count 36
PubMed Score 203.09
PubTator Score 39.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
nephrosclerosis 1.174 4.2e-05
astrocytic glioma -1.600 5.8e-04
oligodendroglioma -1.200 2.1e-02
esophageal adenocarcinoma -1.500 4.9e-02
cutaneous lupus erythematosus -1.300 2.5e-02
psoriasis -1.200 3.5e-03
osteosarcoma 1.572 1.5e-05
posterior fossa group A ependymoma 2.400 3.0e-11
glioblastoma 1.100 9.5e-03
primary pancreatic ductal adenocarcinoma 1.651 1.1e-03
non-small cell lung cancer -2.463 2.8e-27
intraductal papillary-mucinous adenoma (... 1.100 1.7e-02
intraductal papillary-mucinous carcinoma... 1.200 2.6e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.1e-02
lung cancer -3.100 7.7e-05
interstitial cystitis -1.600 1.2e-05
lung adenocarcinoma -3.200 9.1e-17
pilocytic astrocytoma 2.200 9.2e-09
sonic hedgehog group medulloblastoma 1.100 2.8e-03
aldosterone-producing adenoma -1.105 1.8e-02
lung carcinoma -1.700 8.0e-26
spina bifida -1.342 4.6e-02
Breast cancer 1.200 4.1e-08
mucosa-associated lymphoid tissue lympho... 1.608 2.7e-02
ovarian cancer 1.200 2.6e-03
pituitary cancer -1.500 1.5e-07
pancreatic cancer 1.400 6.3e-03

Gene RIF (16)

PMID Text
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
25940704 EMP2 plays a tumor suppressor role by inducing G2/M cell cycle arrest, suppressing cell viability, proliferation, colony formation/ anchorage-independent cell growth via regulation of G2/M checkpoints in distinct-derived cell lines.
25684502 Loss of EMP2 is associated with nasopharyngeal carcinoma.
24814193 We showed that knockdown of EMP2 in podocytes and endothelial cells resulted in an increased amount of CAVEOLIN-1 and decreased cell proliferation, so EMP2 mutations causes a recessive Mendelian form of steroid-sensitive nephrotic syndrome.
24644285 the role of EMP2 in the pathogenesis of GBM a
23838430 EMP2 was identified as a tumor-suppressor gene in urinary tract urothelial carcinoma.
23334331 support the role of EMP2 in the control of the tumor microenvironment and confirm the cytotoxic effects observed by EMP2 treatment in vivo
21637765 Manipulation of EMP2 levels in endometrial cancer cells regulates the phosphorylation of FAK and Src, and promotes their distribution into lipid raft domains.
20670949 EMP2 is expressed in the majority of ovarian tumors and may be a feasible target in vivo.
19010852 EMP2 may be a potential pharmacologic target for human endometrial cancer.
18400107 Targeting of EMP2 to specific locations under the influence of these steroid hormones may be important for integrating the molecular responses required for implantation competence.
17609206 EMP2 regulates caveolin-1 transcription and more substantially its protein levels.
17544801 These findings identify EMP2 as a candidate host protein involved in infection of Chlamydia muridarum. [EMP-2]
16216233 EMP2 induces alphavbeta3 surface expression.
12710941 This protein is expressed in discrete anatomical regions of the eye.
11713717 evaluation as candidate gene for Charcot-Marie-Tooth disease type 1C on chromosome 16p

AA Sequence

MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL      1 - 70
STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG     71 - 140
YSYILAWVAFACTFISGMMYLILRKRK                                               141 - 167
//

Text Mined References (36)

PMID Year Title
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
25940704 2015 The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma.
25684502 2015 Immunohistochemical expression of cytokeratins and epithelial membrane protein 2 in nasopharyngeal carcinoma and its potential implications.
24814193 2014 Mutations in EMP2 cause childhood-onset nephrotic syndrome.
24644285 2014 Epithelial membrane protein-2 (EMP2) activates Src protein and is a novel therapeutic target for glioblastoma.
24448822 2014 Rationale and preclinical efficacy of a novel anti-EMP2 antibody for the treatment of invasive breast cancer.
23838430 2013 Epithelial membrane protein 2 is a prognostic indictor for patients with urothelial carcinoma of the upper urinary tract.
23568457 2013 Genetic variants associated with disordered eating.
23439602 2013 Epithelial membrane protein 2 controls VEGF expression in ARPE-19 cells.
23334331 2013 EMP2 regulates angiogenesis in endometrial cancer cells through induction of VEGF.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
22728127 2012 Anti-EMP2 diabody blocks epithelial membrane protein 2 (EMP2) and FAK mediated collagen gel contraction in ARPE-19 cells.
21637765 2011 Epithelial membrane protein-2 promotes endometrial tumor formation through activation of FAK and Src.
20732626 2010 Family-based genome-wide association scan of attention-deficit/hyperactivity disorder.
20670949 2010 Epithelial membrane protein-2 is a novel therapeutic target in ovarian cancer.
19494199 2009 Functional consequences of interactions between FAK and epithelial membrane protein 2 (EMP2).
19010852 2008 Diabodies targeting epithelial membrane protein 2 reduce tumorigenicity of human endometrial cancer cell lines.
18469192 2009 FAK activation and the role of epithelial membrane protein 2 (EMP2) in collagen gel contraction.
18400107 2008 Steroid hormone regulation of EMP2 expression and localization in the endometrium.
17609206 2007 The tetraspan protein EMP2 regulates expression of caveolin-1.
17544801 2007 Epithelial membrane protein 2 modulates infectivity of Chlamydia muridarum (MoPn).
16487956 2006 Knockdown of the tetraspan protein epithelial membrane protein-2 inhibits implantation in the mouse.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16216233 2005 Epithelial membrane protein-2 regulates surface expression of alphavbeta3 integrin in the endometrium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12710941 2003 Epithelial membrane protein-2 is expressed in discrete anatomical regions of the eye.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107182 2002 Epithelial membrane proteins induce membrane blebbing and interact with the P2X7 receptor C terminus.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11713717 2002 Mapping of Charcot-Marie-Tooth disease type 1C to chromosome 16p identifies a novel locus for demyelinating neuropathies.
10331954 1999 Regional localization of the human epithelial membrane protein genes 1, 2, and 3 (EMP1, EMP2, EMP3) to 12p12.3, 16p13.2, and 19q13.3.
8996089 1996 Characterization of a tumor-associated gene, a member of a novel family of genes encoding membrane glycoproteins.
8917086 1996 Epithelial membrane protein-2 and epithelial membrane protein-3: two novel members of the peripheral myelin protein 22 gene family.
8884260 1996 Identification and characterization of a cDNA and the structural gene encoding the mouse epithelial membrane protein-1.