Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.84
PubTator Score 10.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
gastric carcinoma 1.700 8.0e-03
pancreatic cancer -1.300 1.6e-02
malignant mesothelioma 2.300 3.1e-08
psoriasis -1.200 2.1e-03
osteosarcoma -1.499 8.7e-04
glioblastoma 1.600 2.1e-04
cystic fibrosis -3.216 2.1e-06
medulloblastoma, large-cell 1.300 5.2e-03
primary pancreatic ductal adenocarcinoma 1.137 1.2e-02
lung cancer -1.600 4.3e-03
breast carcinoma -1.100 3.9e-03
fibroadenoma -1.300 2.5e-02
adult high grade glioma 1.600 9.3e-04
pilocytic astrocytoma 2.000 6.3e-06
pancreatic carcinoma -1.300 1.6e-02
subependymal giant cell astrocytoma 3.822 2.3e-02
Breast cancer -1.400 4.6e-02
COPD -1.100 2.9e-02
lung carcinoma -1.300 7.8e-18
invasive ductal carcinoma -1.200 9.6e-03
ulcerative colitis 1.500 4.6e-07
ovarian cancer -2.400 4.4e-07
pituitary cancer 1.500 1.7e-02

Gene RIF (9)

PMID Text
25445627 Data suggested mechanisms for homo- and hetero-typic EMILINs multimers formation: EMILIN1 or EMILIN2 alone can form trimers and multimers in the absence of each other or they can co-polymerize in a head-to-tail fashion to form hetero-typic multimers.
24374807 Identify emilin2 as a key extracellular regulator of the Wnt signalling pathway suppressing breast cancer cell growth and migration.
23593459 Apoptosis plays a fundamental role in maintaining epidermal homeostasis, balancing keratinocytes proliferation, and forming the stratum corneum. EMILIN2 is known to trigger the apoptosis of different cell lines
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360940 The possibility of using EMILIN2 fragments as potent antineoplastic tools for cancer treatment.
19913121 Observational study of gene-disease association. (HuGE Navigator)
17988845 EMILIN1 interacts with anthrax protective antigen and inhibits toxin action in vitro. EMILIN1 may be a potential target and/or a protein useful for countermeasures against B. anthracis toxin lethality.
17698584 Results suggest that the expression of EMILIN2 triggers the apoptosis of different cell lines by activation of death receptors.

AA Sequence

MWQPRRPWPRVPWRWALALLALVGAGLCHAGPQPGYPARPSARNKNWCAYIVNKNVSCSVLEGSESFIQA      1 - 70
QYNCAWNQMPCPSALVYRVNFRPRYVTRYKTVTQLEWRCCPGFRGGDCQEGPKDPVKTLRPTPARPRNSL     71 - 140
KKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEGPQELQEKKIQVLEEKVLRLTRTVLDLQSSLAGVSE    141 - 210
NLKHATQDDASRTRAPGLSSQHPKPDTTVSGDTETGQSPGVFNTKESGMKDIKSELAEVKDTLKNKSDKL    211 - 280
EELDGKVKGYEGQLRQLQEAAQGPTVTMTTNELYQAYVDSKIDALREELMEGMDRKLADLKNSCEYKLTG    281 - 350
LQQQCDDYGSSYLGVIELIGEKETSLRKEINNLRARLQEPSAQANCCDSEKNGDIGQQIKTLDQKIERVA    351 - 420
EATRMLNGRLDNEFDRLIVPEPDVDFDAKWNELDARINVTEKNAEEHCFYIEETLRGAINGEVGDLKQLV    421 - 490
DQKIQSLEDRLGSVLLQMTNNTGAELSPPGAAALPGVSGSGDERVMMELNHLKDKVQVVEDICLLNIQGK    491 - 560
PHGMEGALPNREDRAVRDSLHLLKSLNDTMHRKFQETEQTIQKLQQDFSFLYSQLNHTENDVTHLQKEMS    561 - 630
NCRAGENAGMGRFTKVGEQERTVDTLPSPQHPVAHCCSQLEERWQRLQSQVISELDACKECTQGVQREVS    631 - 700
MVEGRVSHMEKTCSKLDSISGNLQRIKEGLNKHVSSLWNCVRQMNGTLRSHSRDISGLKNSVQQFYSHVF    701 - 770
QISTDLQDLVKFQPSAKAPSPPPPAEAPKEPLQPEPAPPRPSGPATAEDPGRRPVLPQRPPEERPPQPPG    771 - 840
STGVIAETGQAGPPAGAGVSGRGLPRGVDGQTGSGTVPGAEGFAGAPGYPKSPPVASPGAPVPSLVSFSA    841 - 910
GLTQKPFPSDGGVVLFNKVLVNDGDVYNPSTGVFTAPYDGRYLITATLTPERDAYVEAVLSVSNASVAQL    911 - 980
HTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAVNVVVTGGKLAHTDFDEMYSTFSGVFLYPFL    981 - 1050
SHL                                                                      1051 - 1053
//

Text Mined References (18)

PMID Year Title
25445627 2015 Multiple-interactions among EMILIN1 and EMILIN2 N- and C-terminal domains.
24374807 2014 EMILIN2 down-modulates the Wnt signalling pathway and suppresses breast cancer cell growth and migration.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23593459 2013 Identification of an interstitial 18p11.32-p11.31 duplication including the EMILIN2 gene in a family with porokeratosis of Mibelli.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360940 2010 The extracellular matrix glycoprotein elastin microfibril interface located protein 2: a dual role in the tumor microenvironment.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17988845 2008 EMILINs interact with anthrax protective antigen and inhibit toxin action in vitro.
17698584 2007 Regulation of the extrinsic apoptotic pathway by the extracellular matrix glycoprotein EMILIN2.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278945 2001 Isolation and characterization of EMILIN-2, a new component of the growing EMILINs family and a member of the EMI domain-containing superfamily.