Property Summary

NCBI Gene PubMed Count 105
PubMed Score 640.62
PubTator Score 278.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 2.1e-03

Gene RIF (60)

AA Sequence

MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSSAASSYSFSDLNSTRGD      1 - 70
ADMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRAVRQSVTSFPDADAFHHQVHDDDLL     71 - 140
SSSEEECKDRERPMYGRDSAYQSITHYRPVSASRSSLDLSYYPTSSSTSFMSSSSSSSSWLTRRAIRPEN    141 - 210
RAPGAGLGQDRQVPLWGQLLLFLVFVIVLFFIYHFMQAEEGNPF                              211 - 254
//

Text Mined References (120)

PMID Year Title