Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.95
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 6.5e-05
breast carcinoma 1638 1.3e-02
Breast cancer 3578 2.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 2.100 2.8e-02
breast carcinoma 1.400 1.3e-02
ovarian cancer 2.300 6.5e-05

Gene RIF (1)

AA Sequence

MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW      1 - 70
DIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGN     71 - 140
LMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL                               141 - 183
//

Text Mined References (19)

PMID Year Title