Property Summary

NCBI Gene PubMed Count 9
PubMed Score 25.54
PubTator Score 6.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2755 9.9e-33
Astrocytoma, Pilocytic 3006 4.0e-09
osteosarcoma 7766 8.5e-09
atypical teratoid / rhabdoid tumor 4971 9.0e-08
glioblastoma 5635 1.8e-04
psoriasis 6514 4.6e-04
ependymoma 4559 1.6e-02
Disease Target Count Z-score Confidence
Hereditary spherocytosis 16 3.64 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 4.0e-09
atypical teratoid / rhabdoid tumor 1.200 9.0e-08
ependymoma 1.100 1.6e-02
glioblastoma 1.200 1.8e-04
lung carcinoma 1.200 9.9e-33
osteosarcoma -2.200 8.5e-09
psoriasis -1.800 4.6e-04

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK      1 - 70
RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES     71 - 140
HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA    141 - 210
QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR                      211 - 262
//

Text Mined References (14)

PMID Year Title