Property Summary

NCBI Gene PubMed Count 10
PubMed Score 14.17
PubTator Score 42.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 3.7e-03
psoriasis 6685 1.2e-02
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 2.0

Gene RIF (4)

PMID Text
25817725 HCV core protein represses E-cadherin expression by upregulating E12/E47 levels to induce EMT in HCV-associated HCC.
20503194 These biochemical and functional data reveal RANBP16 and RANBP17 as novel regulators of E2A protein action, and demonstrate specific interaction of E12 with RANBP17.
17910069 characterize the assembly of a five-component complex containing TAL1, LMO2, Ldb1, E12, and DNA. The bHLH domains of TAL1 and E12 alone primarily formed helical homodimers, but together formed heterodimers, to which LMO2 bound with high affinity
17307309 Sperm-binding fibronectin type II-module proteins are genetically linked and functionally related.

AA Sequence

MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSED      1 - 70
YPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVV     71 - 140
SDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCAT    141 - 210
SYNYDQDHTWVYC                                                             211 - 223
//

Text Mined References (12)

PMID Year Title
25817725 2015 Hepatitis C virus core protein induces epithelial-mesenchymal transition in human hepatocytes by upregulating E12/E47 levels.
22449649 2012 Genome-wide association study of intelligence: additive effects of novel brain expressed genes.
20503194 2010 Identification of RANBP16 and RANBP17 as novel interaction partners for the bHLH transcription factor E12.
17910069 2008 Assembly of the oncogenic DNA-binding complex LMO2-Ldb1-TAL1-E12.
17307309 2007 Sperm-binding fibronectin type II-module proteins are genetically linked and functionally related.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11144225 2001 Novel sperm-binding proteins of epididymal origin contain four fibronectin type II-modules.
10502414 1999 Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8159721 1994 Formation of in vivo complexes between the TAL1 and E2A polypeptides of leukemic T cells.