Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.96
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer 1.500 6.8e-03
pancreatic cancer 1.900 1.3e-03
astrocytic glioma -1.500 1.8e-02
oligodendroglioma -1.500 1.6e-02
osteosarcoma -2.299 1.6e-02
glioblastoma -2.000 1.1e-03
medulloblastoma -2.400 1.5e-05
atypical teratoid/rhabdoid tumor -1.700 9.8e-05
medulloblastoma, large-cell -3.100 4.2e-06
primitive neuroectodermal tumor -2.000 1.0e-02
tuberculosis and treatment for 6 months -2.200 6.4e-04
interstitial cystitis 1.400 9.0e-03
pediatric high grade glioma -2.000 1.1e-04
pancreatic carcinoma 1.900 1.3e-03
psoriasis 1.400 1.1e-67
lung carcinoma 1.100 1.3e-06
spina bifida -1.531 3.9e-02
progressive supranuclear palsy -1.100 4.9e-02
acute myeloid leukemia -2.900 2.2e-02
ovarian cancer -1.400 2.3e-03

Gene RIF (4)

PMID Text
25732827 ELOVL7 knockdown or mTOR inhibition impairs HCMV-induced fatty acid elongation.
21959040 progression of the VLCFA cycle enhances ELOVL7 activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826053 Overexpression of ELOVL7 is associated with prostate cancer growth through saturated long-chain fatty acid metabolism.

AA Sequence

MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMIT      1 - 70
YNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKN     71 - 140
SQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSL    141 - 210
QLVQFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKD    211 - 280
N//

Text Mined References (12)

PMID Year Title
25732827 2015 Fatty acid elongase 7 catalyzes lipidome remodeling essential for human cytomegalovirus replication.
25416956 2014 A proteome-scale map of the human interactome network.
21959040 2011 Biochemical characterization of the very long-chain fatty acid elongase ELOVL7.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19826053 2009 Novel lipogenic enzyme ELOVL7 is involved in prostate cancer growth through saturated long-chain fatty acid metabolism.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8944226 1996 Biosynthesis of triacylglycerols.