Property Summary

NCBI Gene PubMed Count 26
PubMed Score 85.23
PubTator Score 32.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.800 7.2e-06
ependymoma -2.100 2.1e-02
group 4 medulloblastoma 2.300 9.1e-05
cystic fibrosis -2.942 9.6e-06
atypical teratoid / rhabdoid tumor 1.400 3.0e-02
medulloblastoma, large-cell 2.500 1.1e-05
pilocytic astrocytoma -1.600 1.1e-04
lung carcinoma 3.700 1.3e-41
Alzheimer's disease -1.200 3.4e-02
Pick disease -1.300 4.1e-04
progressive supranuclear palsy -1.100 2.1e-02
pituitary cancer 2.200 5.3e-04

Protein-protein Interaction (4)

Gene RIF (11)

PMID Text
26633493 Polymorphisms in the ELOVL2 gene were not associated with the risk of developing allergic disease
25450787 results show that the ELOVL2 locus provides a very good source of information about human chronological age based on analysis of blood, including bloodstains, and it may constitute a powerful and reliable predictor in future forensic age estimation models
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of ELOVL fatty acid elongase 2 (ELOVL2) in primary human brain microvascular endothelial cells
23555103 we do not found the association between rs3756593 of ELOVL2 gene and acute coronary syndrome in Chinese Han population
23061750 Methylation of ELOVL2 gene is a new epigenetic marker of age.
21917437 gene interaction analysis showed that the combined genotype of FADS1 rs174556 (T/T) and ELOVL2 rs3756963 (T/T) was weakly associated with coronary artery disease
21560298 rs3756963 in ELOVL2 gene may be associated with paranoid schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20037589 Observational study of gene-disease association. (HuGE Navigator)
19148276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL      1 - 70
YNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS     71 - 140
QITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL    141 - 210
VQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFS    211 - 280
KAYFTAANGVMNKKAQ                                                          281 - 296
//

Text Mined References (28)

PMID Year Title
26633493 2015 Single Nucleotide Polymorphisms in the FADS Gene Cluster but not the ELOVL2 Gene are Associated with Serum Polyunsaturated Fatty Acid Composition and Development of Allergy (in a Swedish Birth Cohort).
25450787 2015 Examination of DNA methylation status of the ELOVL2 marker may be useful for human age prediction in forensic science.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23555103 2013 A case-control study between gene polymorphisms of polyunsaturated fatty acid metabolic rate-limiting enzymes and acute coronary syndrome in Chinese Han population.
23061750 2012 Methylation of ELOVL2 gene as a new epigenetic marker of age.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21917437 2011 A case-control study between the gene polymorphisms of polyunsaturated fatty acids metabolic rate-limiting enzymes and coronary artery disease in a Chinese Han population.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21560298 2011 [A case-control study between gene polymorphisms of polyunsaturated fatty acids metabolic rate-limiting enzymes and paranoid schizophrenia of Han ethnicity in Jilin Province].
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20037589 2010 A genome-wide perspective of genetic variation in human metabolism.
19148276 2009 Genome-wide association study of plasma polyunsaturated fatty acids in the InCHIANTI Study.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17583696 2007 ELOVL2 overexpression enhances triacylglycerol synthesis in 3T3-L1 and F442A cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16564093 2006 Fatty acid elongases in mammals: their regulation and roles in metabolism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636670 2004 Elongation of long-chain fatty acids.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371743 2002 Identification and expression of mammalian long-chain PUFA elongation enzymes.
10970790 2000 Cloning of a human cDNA encoding a novel enzyme involved in the elongation of long-chain polyunsaturated fatty acids.
8944226 1996 Biosynthesis of triacylglycerols.