Tbio | Elongation of very long chain fatty acids protein 1 |
Catalyzes the first and rate-limiting reaction of the four that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. Condensing enzyme that exhibits activity toward saturated C18 to C26 acyl-CoA substrates, with the highest activity towards C22:0 acyl-CoA. May participate in the production of both saturated and monounsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators. Important for saturated C24:0 and monounsaturated C24:1 sphingolipid synthesis. Indirectly inhibits RPE65 via production of VLCFAs.
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8520 | 1.8e-05 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 4.7e-04 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 7.5e-04 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 1.1e-03 |
group 4 medulloblastoma | 1855 | 4.6e-03 |
osteosarcoma | 7950 | 7.2e-03 |
progressive supranuclear palsy | 676 | 4.1e-02 |
subependymal giant cell astrocytoma | 2287 | 4.9e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Adrenoleukodystrophy | 29 | 5.456 | 2.7 |
Peroxisomal disease | 22 | 4.375 | 2.2 |
Ichthyosis | 56 | 3.306 | 1.7 |
Disease | log2 FC | p |
---|---|---|
group 4 medulloblastoma | -1.400 | 4.6e-03 |
intraductal papillary-mucinous adenoma (... | 1.200 | 4.7e-04 |
intraductal papillary-mucinous carcinoma... | 1.400 | 7.5e-04 |
intraductal papillary-mucinous neoplasm ... | 1.800 | 1.1e-03 |
osteosarcoma | -1.055 | 7.2e-03 |
ovarian cancer | 1.700 | 1.8e-05 |
progressive supranuclear palsy | -1.200 | 4.1e-02 |
subependymal giant cell astrocytoma | -1.267 | 4.9e-02 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA |
MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV 1 - 70 ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL 71 - 140 HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV 141 - 210 LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN 211 - 279 //