Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.74
PubTator Score 26.62

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV      1 - 70
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL     71 - 140
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV    141 - 210
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN     211 - 279
//

Text Mined References (20)

PMID Year Title