Property Summary

NCBI Gene PubMed Count 57
PubMed Score 36.69
PubTator Score 60.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.4e-05
Multiple myeloma 1327 1.8e-03
diabetes mellitus 1663 1.8e-03
Waldenstrons macroglobulinemia 764 1.7e-02
acute myeloid leukemia 785 4.2e-02
Disease Target Count Z-score Confidence
Hemangioma 35 3.955 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.178 1.7e-02
Multiple myeloma 1.342 1.8e-03
diabetes mellitus -2.500 1.8e-03
acute myeloid leukemia -1.200 4.2e-02
ovarian cancer 2.100 6.4e-05

Gene RIF (49)

PMID Text
26531153 Study shows that TCEB2 is involved in the development of acquired resistance to bevacizumab in ovarian cancer cells via the mechanisms of suppression of VEGF-A expression by promoting HIF-1alpha degradation and induction of interleukin-8 (IL-8) expression.
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25981045 HIV-1 complexes with TCEB2 (ELOB)
25912140 HIV-1 complexes with TCEB2 (ELOB)
25901786 HIV-1 complexes with TCEB2 (ELOB)
25661653 The crystal structure of VHL bound to a Cul2 N-terminal domain, Elongin B, and Elongin C.
25408426 HIV-1 complexes with TCEB2 (ELOB)
25124760 HIV-1 complexes with TCEB2 (ELOB)
24586532 HIV-1 complexes with TCEB2 (ELOB)
24402281 HIV-1 complexes with TCEB2 (ELOB)
24352440 HIV-1 complexes with TCEB2 (ELOB)
24225024 HIV-1 complexes with TCEB2 (ELOB)
23988114 Vif interaction with EloB-EloC may contribute to recruitment of CBF-beta to Vif, demonstrating that the EloB C-teminus may play a role in improving Vif function and that the over-expression of EloB results in Vif stabilization.
23988114 HIV-1 complexes with TCEB2 (ELOB)
23837592 ASB9 is unstable alone but forms a stable ternary complex with EloBC that binds with high affinity to the Cullin 5 N-terminal domain.
23621690 HIV-1 complexes with TCEB2 (ELOB)
23333304 HIV-1 complexes with TCEB2 (ELOB)
22402281 HIV-1 complexes with TCEB2 (ELOB)
22402277 HIV-1 complexes with TCEB2 (ELOB)
22190037 HIV-1 complexes with TCEB2 (ELOB)
22190036 HIV-1 complexes with TCEB2 (ELOB)
22190034 HIV-1 complexes with TCEB2 (ELOB)
21447700 Elongin B also enhances gene expression from the double-stranded DNA genome of human cytomegalovirus.
20728451 Recombinant full-length Vif interacted with the Elongin BC complex in vitro with a K(d) of 1.9 muM and resulted in observable changes in deuterium uptake in both Elongin C and B.
20728451 HIV-1 complexes with TCEB2 (ELOB)
20532212 HIV-1 complexes with TCEB2 (ELOB)
20463065 HIV-1 complexes with TCEB2 (ELOB)
20450485 HIV-1 complexes with TCEB2 (ELOB)
20174454 HIV-1 complexes with TCEB2 (ELOB)
20096141 HIV-1 complexes with TCEB2 (ELOB)
19218568 HIV-1 complexes with TCEB2 (ELOB)
19038776 HIV-1 complexes with TCEB2 (ELOB)
19008196 HIV-1 complexes with TCEB2 (ELOB)
18789977 HIV-1 complexes with TCEB2 (ELOB)
18562529 HIV-1 complexes with TCEB2 (ELOB)
18541215 HIV-1 complexes with TCEB2 (ELOB)
18508766 Elongin B/C recruitment regulates substrate binding by CIS
17690245 HIV-1 complexes with TCEB2 (ELOB)
17611602 nuclear level of active P-TEFb is controlled by dynamic and reversible remodelling of 7SK snRNP
17285170 HIV-1 complexes with TCEB2 (ELOB)
16675548 Results describe the 1.9-A crystal structure of the ternary complex of SOCS2 with elongin C and elongin B.
16303161 HIV-1 complexes with TCEB2 (ELOB)
15781449 the E3 ubiquitin ligase activity of the Vif-BC-Cul5 complex is essential for Vif function against APOBEC3G
15590664 show that ASB2, by interacting with the Elongin BC complex, can assemble with Cullin5.Rbx1 to form an E3 ubiquitin ligase complex that stimulates polyubiquitination by the E2 ubiquitin-conjugating enzyme Ubc5
15574593 HIV-1 complexes with TCEB2 (ELOB)
15574592 HIV-1 complexes with TCEB2 (ELOB)
14564014 findings report that HIV-1 Vif interacts with cellular proteins Cul5, elongins B and C, and Rbx1 to form an Skp1-cullin-F-box (SCF)-like complex
14564014 HIV-1 complexes with TCEB2 (ELOB)
9765201 HIV-1 complexes with TCEB2 (ELOB)

AA Sequence

MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQ      1 - 70
APATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ                           71 - 118
//

Text Mined References (65)

PMID Year Title
26531153 2016 TCEB2 confers resistance to VEGF-targeted therapy in ovarian cancer.
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25661653 2015 Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988114 2013 Interactions between HIV-1 Vif and human ElonginB-ElonginC are important for CBF-? binding to Vif.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22286099 2012 The LIMD1 protein bridges an association between the prolyl hydroxylases and VHL to repress HIF-1 activity.
22190034 2011 Global landscape of HIV-human protein complexes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21447700 2011 Elongin B-mediated epigenetic alteration of viral chromatin correlates with efficient human cytomegalovirus gene expression and replication.
21269460 2011 Initial characterization of the human central proteome.
20871634 2011 Regulation of receptor for activated C kinase 1 protein by the von Hippel-Lindau tumor suppressor in IGF-I-induced renal carcinoma cell invasiveness.
20728451 2010 Molecular insight into the conformational dynamics of the Elongin BC complex and its interaction with HIV-1 Vif.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18508766 2008 Elongin B/C recruitment regulates substrate binding by CIS.
18323857 2008 NEDD8 acts as a 'molecular switch' defining the functional selectivity of VHL.
17997974 2007 Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.
17636018 2007 ASB4 is a hydroxylation substrate of FIH and promotes vascular differentiation via an oxygen-dependent mechanism.
17611602 2007 Dynamic remodelling of human 7SK snRNP controls the nuclear level of active P-TEFb.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17189197 2006 Structural basis for protein recognition by B30.2/SPRY domains.
16675548 2006 Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
16503656 2006 Analysis of Nedd8-associated polypeptides: a model for deciphering the pathway for ubiquitin-like modifications.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15781449 2005 Ubiquitination of APOBEC3G by an HIV-1 Vif-Cullin5-Elongin B-Elongin C complex is essential for Vif function.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15590694 2005 Suppressors of cytokine signaling 4 and 5 regulate epidermal growth factor receptor signaling.
15590664 2005 ASB2 is an Elongin BC-interacting protein that can assemble with Cullin 5 and Rbx1 to reconstitute an E3 ubiquitin ligase complex.
15574592 2004 Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14960280 2004 Ozz-E3, a muscle-specific ubiquitin ligase, regulates beta-catenin degradation during myogenesis.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
12943681 2003 Identification of EloA-BP1, a novel Elongin A binding protein with an exonuclease homology domain.
12676794 2003 The RNA polymerase II elongation complex.
12559969 2003 Molecular cloning and characterization of the human ASB-8 gene encoding a novel member of ankyrin repeat and SOCS box containing protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149480 2002 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase.
12052866 2002 SOCS-6 binds to insulin receptor substrate 4, and mice lacking the SOCS-6 gene exhibit mild growth retardation.
12050673 2002 Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
12004076 2002 Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling.
11994304 2002 Identification and biochemical characterization of a novel transcription elongation factor, Elongin A3.
11739384 2002 Ubiquitination of a novel deubiquitinating enzyme requires direct binding to von Hippel-Lindau tumor suppressor protein.
11384984 2001 Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
11006129 2000 Drosophila von Hippel-Lindau tumor suppressor complex possesses E3 ubiquitin ligase activity.
10973499 2000 Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.
10692460 2000 Identification and characterization of Elongin A2, a new member of the Elongin family of transcription elongation factors, specifically expressed in the testis.
10587522 1999 Synthetic peptides define critical contacts between elongin C, elongin B, and the von Hippel-Lindau protein.
10535940 1999 Identification of the von Hippel-lindau tumor-suppressor protein as part of an active E3 ubiquitin ligase complex.
10449727 1999 Studying interactions of four proteins in the yeast two-hybrid system: structural resemblance of the pVHL/elongin BC/hCUL-2 complex with the ubiquitin ligase complex SKP1/cullin/F-box protein.
10205047 1999 Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
10051596 1999 The conserved SOCS box motif in suppressors of cytokine signaling binds to elongins B and C and may couple bound proteins to proteasomal degradation.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9122164 1997 The von Hippel-Lindau tumor-suppressor gene product forms a stable complex with human CUL-2, a member of the Cdc53 family of proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8244996 1993 RNA polymerase II transcription factor SIII. I. Identification, purification, and properties.
7660130 1995 Binding of the von Hippel-Lindau tumor suppressor protein to Elongin B and C.
7660129 1995 Elongin (SIII): a multisubunit regulator of elongation by RNA polymerase II.
7660122 1995 Inhibition of transcription elongation by the VHL tumor suppressor protein.
7638163 1995 Positive regulation of general transcription factor SIII by a tailed ubiquitin homolog.