Property Summary

NCBI Gene PubMed Count 29
PubMed Score 20.80
PubTator Score 24.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Inflammatory dermatosis 38
Disease Target Count Z-score Confidence
Cleft Lip 91 3.016 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 2.000 4.5e-05
osteosarcoma 1.922 8.8e-08
glioblastoma 1.500 1.4e-06
atypical teratoid / rhabdoid tumor 1.400 2.3e-07
medulloblastoma, large-cell 1.600 3.8e-05
pediatric high grade glioma 1.300 5.7e-08
ovarian cancer 1.400 5.0e-06

Synonym

Accession Q14241 B2R7Q8 Q8IXH1
Symbols SIII
TCEB3
TCEB3A
SIII p110

Gene

PANTHER Protein Class (1)

PDB

4HFX  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (7)

PMID Text
24351681 TCEB3C is a putative tumor suppressor gene of small intestinal neuroendocrine tumors
23828199 Elongin A transcription elongation activity, but not its ubiquitination activity, is most important for its function in induction of transcription of ATF3 and p21.
19730683 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of transcription elongation factor B (SIII), polypeptide 3 (TCEB3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of transcription elongation factor B (SIII), polypeptide 3 (TCEB3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17690245 HIV-1 Nef expression in HeLa cells upregulates transcription elongation factor B (SIII; elongin A) expression
11810028 HIV-1 Nef expression in HeLa cells upregulates transcription elongation factor B (SIII; elongin A) expression

AA Sequence

MHGGRSCGPRTRREPSSGEEAAPVTAMAAESALQVVEKLQARLAANPDPKKLLKYLKKLSTLPITVDILA      1 - 70
ETGVGKTVNSLRKHEHVGSFARDLVAQWKKLVPVERNAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQE     71 - 140
TWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCT    141 - 210
SPHQMYVDHYRSLEEDQEPIVSHQKPGKGHSNAFQDRLGASQERHLGEPHGKGVVSQNKEHKSSHKDKRP    211 - 280
VDAKSDEKASVVSREKSHKALSKEENRRPPSGDNAREKPPSSGVKKEKDREGSSLKKKCLPPSEAASDNH    281 - 350
LKKPKHRDPEKAKLDKSKQGLDSFDTGKGAGDLLPKVKEKGSNNLKTPEGKVKTNLDRKSLGSLPKVEET    351 - 420
DMEDEFEQPTMSFESYLSYDQPRKKKKKIVKTSATALGDKGLKKNDSKSTGKNLDSVQKLPKVNKTKSEK    421 - 490
PAGADLAKLRKVPDVLPVLPDLPLPAIQANYRPLPSLELISSFQPKRKAFSSPQEEEEAGFTGRRMNSKM    491 - 560
QVYSGSKCAYLPKMMTLHQQCIRVLKNNIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETD    561 - 630
QLWKVHCHRDFKEERPEEYESWREMYLRLQDAREQRLRVLTKNIQFAHANKPKGRQAKMAFVNSVAKPPR    631 - 700
DVRRRQEKFGTGGAAVPEKIKIKPAPYPMGSSHASASSISFNPSPEEPAYDGPSTSSAHLAPVVSSTVSY    701 - 770
DPRKPTVKKIAPMMAKTIKAFKNRFSRR                                              771 - 798
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24351681 2014 TCEB3C a putative tumor suppressor gene of small intestinal neuroendocrine tumors.
23828199 2013 Transcriptional properties of mammalian elongin A and its role in stress response.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16498413 2006 Structural and functional insights into the B30.2/SPRY domain.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15207703 2004 Bmx is a downstream Rap1 effector in VEGF-induced endothelial cell activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12943681 2003 Identification of EloA-BP1, a novel Elongin A binding protein with an exonuclease homology domain.
12676794 2003 The RNA polymerase II elongation complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11994304 2002 Identification and biochemical characterization of a novel transcription elongation factor, Elongin A3.
11384984 2001 Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
10587522 1999 Synthetic peptides define critical contacts between elongin C, elongin B, and the von Hippel-Lindau protein.
9806752 1998 Factors regulating the transcriptional elongation activity of RNA polymerase II.
9305922 1997 Interaction of elongation factors TFIIS and elongin A with a human RNA polymerase II holoenzyme capable of promoter-specific initiation and responsive to transcriptional activators.
9110174 1997 Large-scale concatenation cDNA sequencing.
8654961 1996 A human cDNA encoding the 110-kDa A subunit of RNA polymerase II transcription factor elongin.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8586449 1995 Assignment of a human gene encoding the 110-kDa subunit of general transcription factor elongin (SIII) to chromosome 1p36.1.
7660129 1995 Elongin (SIII): a multisubunit regulator of elongation by RNA polymerase II.