Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.68
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.200 2.2e-02
posterior fossa group A ependymoma -4.400 1.8e-15
oligodendroglioma -2.100 4.5e-12
glioblastoma -3.300 1.4e-03
osteosarcoma 1.615 2.1e-02
sonic hedgehog group medulloblastoma -5.100 1.2e-07
periodontitis -1.400 1.5e-22
atypical teratoid / rhabdoid tumor -5.200 1.2e-07
medulloblastoma, large-cell -4.100 3.1e-05
primitive neuroectodermal tumor -2.500 1.4e-02
Atopic dermatitis -2.800 4.3e-05
pediatric high grade glioma -2.700 6.7e-04
pilocytic astrocytoma -1.300 4.4e-06
aldosterone-producing adenoma -1.470 1.9e-02
psoriasis -1.400 6.4e-15
Pick disease -1.900 2.4e-02

Synonym

Accession Q8N336 B4E167 G5E9S5 Q9NPW3
Symbols

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (5)

PMID Text
24616099 The non-opioid sigma-1 receptor (S1R) was identified as a novel effector of GAP activity of ELMOD1-3 proteins as its direct binding to either ELMOD1 or ELMOD2 resulted in loss of GAP activity.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV      1 - 70
SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK     71 - 140
LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI    141 - 210
TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL    211 - 280
MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM                    281 - 334
//

Text Mined References (15)

PMID Year Title
24616099 2014 Characterization of recombinant ELMOD (cell engulfment and motility domain) proteins as GTPase-activating proteins (GAPs) for ARF family GTPases.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20585627 2010 Web-based, participant-driven studies yield novel genetic associations for common traits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452337 2007 ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.