| Tbio | ELMO domain-containing protein 1 |
Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.
Comments
| Disease | Target Count | P-value |
|---|---|---|
| periodontitis | 269 | 1.5e-22 |
| posterior fossa group A ependymoma | 1511 | 1.8e-15 |
| psoriasis | 6685 | 6.4e-15 |
| oligodendroglioma | 2849 | 4.5e-12 |
| sonic hedgehog group medulloblastoma | 1482 | 1.2e-07 |
| atypical teratoid / rhabdoid tumor | 4369 | 1.2e-07 |
| pilocytic astrocytoma | 3086 | 4.4e-06 |
| medulloblastoma, large-cell | 6234 | 3.1e-05 |
| Atopic dermatitis | 944 | 4.3e-05 |
| pediatric high grade glioma | 2712 | 6.7e-04 |
| glioblastoma | 5572 | 1.4e-03 |
| primitive neuroectodermal tumor | 3031 | 1.4e-02 |
| aldosterone-producing adenoma | 664 | 1.9e-02 |
| osteosarcoma | 7933 | 2.1e-02 |
| astrocytic glioma | 2241 | 2.2e-02 |
| Pick disease | 1893 | 2.4e-02 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | -2.200 | 2.2e-02 |
| posterior fossa group A ependymoma | -4.400 | 1.8e-15 |
| oligodendroglioma | -2.100 | 4.5e-12 |
| glioblastoma | -3.300 | 1.4e-03 |
| osteosarcoma | 1.615 | 2.1e-02 |
| sonic hedgehog group medulloblastoma | -5.100 | 1.2e-07 |
| periodontitis | -1.400 | 1.5e-22 |
| atypical teratoid / rhabdoid tumor | -5.200 | 1.2e-07 |
| medulloblastoma, large-cell | -4.100 | 3.1e-05 |
| primitive neuroectodermal tumor | -2.500 | 1.4e-02 |
| Atopic dermatitis | -2.800 | 4.3e-05 |
| pediatric high grade glioma | -2.700 | 6.7e-04 |
| pilocytic astrocytoma | -1.300 | 4.4e-06 |
| aldosterone-producing adenoma | -1.470 | 1.9e-02 |
| psoriasis | -1.400 | 6.4e-15 |
| Pick disease | -1.900 | 2.4e-02 |
| PMID | Text | |
|---|---|---|
| 24616099 | The non-opioid sigma-1 receptor (S1R) was identified as a novel effector of GAP activity of ELMOD1-3 proteins as its direct binding to either ELMOD1 or ELMOD2 resulted in loss of GAP activity. | |
| 20677014 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) |
MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSV 1 - 70 SVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLK 71 - 140 LWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDI 141 - 210 TKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYL 211 - 280 MHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM 281 - 334 //
| PMID | Year | Title | |
|---|---|---|---|
| 24616099 | 2014 | Characterization of recombinant ELMOD (cell engulfment and motility domain) proteins as GTPase-activating proteins (GAPs) for ARF family GTPases. | |
| 24270810 | 2013 | High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy. | |
| 20677014 | 2010 | An approach based on a genome-wide association study reveals candidate loci for narcolepsy. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20585627 | 2010 | Web-based, participant-driven studies yield novel genetic associations for common traits. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. | |
| 17452337 | 2007 | ELMOD2 is an Arl2 GTPase-activating protein that also acts on Arfs. | |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. | |
| 16189514 | 2005 | Towards a proteome-scale map of the human protein-protein interaction network. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
