Property Summary

NCBI Gene PubMed Count 66
PubMed Score 42.13
PubTator Score 36.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma 1.300 1.0e-03
glioblastoma -2.000 1.2e-04
ependymoma -3.100 5.1e-19
group 3 medulloblastoma -2.700 1.7e-06
atypical teratoid / rhabdoid tumor -3.000 4.5e-08
medulloblastoma, large-cell -2.600 1.1e-03
non-small cell lung carcinoma -1.400 4.2e-26
intraductal papillary-mucinous adenoma (... -1.100 7.5e-03
intraductal papillary-mucinous neoplasm ... -1.100 3.9e-02
lung cancer -3.000 4.8e-06
interstitial cystitis 1.600 1.2e-04
lung adenocarcinoma -1.100 2.6e-11
pediatric high grade glioma -1.700 1.2e-04
pilocytic astrocytoma -1.300 1.5e-04
subependymal giant cell astrocytoma -2.571 2.2e-02
lung carcinoma 2.600 2.0e-45
Pick disease -1.400 3.5e-03
ulcerative colitis 1.300 1.9e-03
ovarian cancer 1.400 1.8e-07

Gene RIF (45)

PMID Text
26882976 Cdc27 is a novel binding partner of Elmo1.Cdc27-Elmo1 has a cellular role independent from the Elmo-Dock1-Rac signal module.
26205662 Src-mediated Y724 phosphorylation in ELMO1 plays a critical role for cell spreading via activation of Rac1, leading to promotion of cell migration.
25901943 ELMO1 is expressed in rheumatoid arthritis synovium, promotes cell migration and invasion, and regulates Rac1 activity, thereby mediating rheumatoid arthritis pathogenicity.
25586182 Thus, Elmo1 and Dock180 facilitate blood vessel formation by stabilization of the endothelium during angiogenesis.
25360637 high ELMO1 expression is an independent negative prognostic factor in normal karyotype (NK) acute myeloid leukemia.
25167351 There is a low frequency rate of the ancestral genotype for the ELMO1 polymorphism rs1345365 in mestizos from the western and southeastern regions of Mexico.
24928514 the present study characterized a novel Nck-1-ELMO1 interaction and defined a new role for Nck-1 in regulating Rac1 activity.
24821968 findings reveal a previously unknown, nonredundant role for Elmo1 in controlling Dock2 levels and Dock2-dependent T cell migration in primary lymphocytes.
24819662 High ELMO1 expression is associated with serous ovarian cancer.
24433479 For ELMO1 (+9170 G>A), the GG genotype frequency was higher in the diabetic versus control group, but there were no differences between diabetic patients with and without nephropathies.
23986795 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
23591873 findings indicate that a chemokine-controlled pathway, consisting of Galphai2, ELMO1/Dock180, Rac1 and Rac2, regulates the actin cytoskeleton during breast cancer metastasis
23525077 ELMO1 mutations are associated with esophageal adenocarcinoma.
23156397 Analysis of SNP databases of Japanese patuients with diabetic nephropathy revealed ELMO1 as a gene related to the above-cited diabetic complication.
22844345 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
22842811 genetic association study in population in China: Data suggest that 2 SNPs in ELMO1 (rs741301; rs10951509) are associated with diabetic nephropathy in Chinese subjects with type 2 diabetes.
22503503 findings suggest that clearance of apoptotic cells in living vertebrates is accomplished by the combined actions of apoptotic cell migration and elmo1-dependent macrophage engulfment
22415709 Over-expression of NELL1 is associated with alveolar rhabdomyosarcoma.
22331897 The C-terminal Pro-rich tail of ELMO1 winds around the Src-homology 3 domain of DOCK2 to form an intermolecular 5-helix bundle. The entire regions of both DOCK2 a& ELMO1 assemble to create a rigid structure required for the DOCK2 & ELMO1 binding.
20958313 findings demonstrate an in vivo role for ELMO1-dependent clearance in the testes, with implications for spermatogenesis
20826100 We sequenced 17.4 kb of ELMO1 and identified 19 variants.
20826100 Observational study of gene-disease association. (HuGE Navigator)
20732417 The protein-protein interaction between ELMO1 and COX-2 increased the cyclooxygenase activity of COX-2 and, correspondingly, fibronectin expression.(ELMO1 protein, human)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20299368 Observational study of gene-disease association. (HuGE Navigator)
19929986 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19651817 Report of genetic associations in ELMO1 with diabetic nephropathy, further establishing its role in the susceptibility of this disease.
19651817 Observational study of gene-disease association. (HuGE Navigator)
19183347 Variants in intron 13 of the ELMO1 gene appear to confer risk for diabetic nephropathy in African Americans.
19183347 Observational study of gene-disease association. (HuGE Navigator)
18768751 The DOCK180-ELMO1 interaction is mapped to the N-terminal 200 amino acids of DOCK180, and to the C-terminal 200 amino acids of ELMO1, comprising the ELMO1 PH domain.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17671188 Overexpression of ELMO1 and Dock180, a bipartite Rac1 guanine nucleotide exchange factor is associated with glioma cell invasion
17173036 Using pulldown assays, we identified engulfment and cell motility (ELMO) protein as the IpgB1 binding partner. IpgB1 colocalized with ELMO and Dock180 in membrane ruffles induced by Shigella.
16213822 ARNO and ARF6 coordinate with the Dock180/Elmo complex to promote Rac activation at the leading edge of migrating cells.
15952790 Src family kinase mediated tyrosine phosphorylation of ELMO1 might represent an important regulatory mechanism that controls signaling through the ELMO1/Crk/Dock180 pathway.
15793258 Observational study of gene-disease association. (HuGE Navigator)
15793258 These results indicate that ELMO1 is a novel candidate gene that both confers susceptibility to diabetic nephropathy and plays an important role in the development and progression of this disease.
15723800 ELMO binding to the SH3 domain of Dock180 disrupted the SH3:Docker interaction, facilitated Rac access to the Docker domain, and contributed to the GEF activity of the Dock180/ELMO complex.
15700267 while N-terminal SH3 of CrkII promotes assembly between CrkII and DOCK180, the C-terminal SH3 of CrkII regulates the stability and turnover of the DOCK180/ELMO complex
14737186 Nef binds the DOCK2-ELMO1 complex to activate rac and inhibit lymphocyte chemotaxis
14737186 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
14638695 Rac activation by the ELMO.Dock180 complex at discrete intracellular locations mediated by the N-terminal 330 amino acids of ELMO1 plays a role in cell migration
12829596 the association of DOCK2 with ELMO1 is critical for DOCK2-mediated Rac activation, thereby suggesting that their association might be a therapeutic target for immunologic disorders caused by lymphocyte infiltration
12134158 Dock180 ELMO complex functions as an unconventional two-part exchange factor for Rac.

AA Sequence

MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFYITEKNRNEIK      1 - 70
NGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERY     71 - 140
QKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAFIKKIASFVNKSAIDISILQRSLAILESMVL    141 - 210
NSHDLYQKVAQEITIGQLIPHLQGSDQEIQTYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVI    211 - 280
RAQRAINNEMAHQLYVLQVLTFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKS    281 - 350
MYTRDYKKLGFINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL    351 - 420
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVMQVVKEQVMR    421 - 490
ALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPEILELIKQQRLNRLVEGT    491 - 560
CFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGA    561 - 630
LKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLD    631 - 700
LENIQIPDAPPPIPKEPSNYDFVYDCN                                               701 - 727
//

Text Mined References (73)

PMID Year Title
26882976 2016 Identification of a novel protein interaction between Elmo1 and Cdc27.
26205662 2015 Tyr724 phosphorylation of ELMO1 by Src is involved in cell spreading and migration via Rac1 activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901943 2015 Integrative omics analysis of rheumatoid arthritis identifies non-obvious therapeutic targets.
25586182 2015 The bipartite rac1 Guanine nucleotide exchange factor engulfment and cell motility 1/dedicator of cytokinesis 180 (elmo1/dock180) protects endothelial cells from apoptosis in blood vessel development.
25416956 2014 A proteome-scale map of the human interactome network.
25360637 2014 ELMO1 is upregulated in AML CD34+ stem/progenitor cells, mediates chemotaxis and predicts poor prognosis in normal karyotype AML.
25167351 [Polymorphism g.37190613 G>A of the ELMO1 gene in the Mexican population: potential marker for clinical-surgical pathology].
24928514 2014 A novel interaction between the SH2 domain of signaling adaptor protein Nck-1 and the upstream regulator of the Rho family GTPase Rac1 engulfment and cell motility 1 (ELMO1) promotes Rac1 activation and cell motility.
24821968 2014 Essential role of Elmo1 in Dock2-dependent lymphocyte migration.
24819662 2014 Elmo1 helps dock180 to regulate Rac1 activity and cell migration of ovarian cancer.
24567399 2014 G-protein coupled receptor BAI3 promotes myoblast fusion in vertebrates.
24433479 2014 Variations in CCR5, but not HFE, ELMO1, or SLC12A3, are associated with susceptibility to kidney disease in north Indian individuals with type 2 diabetes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23591873 2013 Association between G?i2 and ELMO1/Dock180 connects chemokine signalling with Rac activation and metastasis.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23525077 2013 Exome and whole-genome sequencing of esophageal adenocarcinoma identifies recurrent driver events and mutational complexity.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23156397 2012 [Genetic study for diabetic microvascular complications--recent advances and future perspectives].
22842811 2013 Association of ELMO1 gene polymorphisms with diabetic nephropathy in Chinese population.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22503503 2012 Apoptotic cells are cleared by directional migration and elmo1- dependent macrophage engulfment.
22415709 2012 The over-expression of cell migratory genes in alveolar rhabdomyosarcoma could contribute to metastatic spread.
22331897 2012 Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21269460 2011 Initial characterization of the human central proteome.
21035343 2010 An evolutionarily conserved autoinhibitory molecular switch in ELMO proteins regulates Rac signaling.
20958313 2010 ELMO1 signaling in apoptotic germ cell clearance and spermatogenesis.
20869035 2010 BMPER mutation in diaphanospondylodysostosis identified by ancestral autozygosity mapping and targeted high-throughput sequencing.
20826100 2010 ELMO1 variants and susceptibility to diabetic nephropathy in American Indians.
20732417 2011 Upregulation of fibronectin expression by COX-2 is mediated by interaction with ELMO1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20299368 2010 Examination of association with candidate genes for diabetic nephropathy in a Mexican American population.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19946888 2010 Defining the membrane proteome of NK cells.
19929986 2009 Genome-wide SNP genotyping study using pooled DNA to identify candidate markers mediating susceptibility to end-stage renal disease attributed to Type 1 diabetes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19651817 2009 Confirmation of genetic associations at ELMO1 in the GoKinD collection supports its role as a susceptibility gene in diabetic nephropathy.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19183347 2009 Variants in intron 13 of the ELMO1 gene are associated with diabetic nephropathy in African Americans.
19176441 2009 Genome-wide interrogation of germline genetic variation associated with treatment response in childhood acute lymphoblastic leukemia.
18768751 2008 An alpha-helical extension of the ELMO1 pleckstrin homology domain mediates direct interaction to DOCK180 and is critical in Rac signaling.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
17881735 2007 Interaction of ezrin with the novel guanine nucleotide exchange factor PLEKHG6 promotes RhoG-dependent apical cytoskeleton rearrangements in epithelial cells.
17671188 2007 ELMO1 and Dock180, a bipartite Rac1 guanine nucleotide exchange factor, promote human glioma cell invasion.
17653210 2007 Genetic variations associated with diabetic nephropathy and type II diabetes in a Japanese population.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17173036 2007 Shigella IpgB1 promotes bacterial entry through the ELMO-Dock180 machinery.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16213822 2005 The DOCK180/Elmo complex couples ARNO-mediated Arf6 activation to the downstream activation of Rac1.
15952790 2005 Identification of tyrosine residues on ELMO1 that are phosphorylated by the Src-family kinase Hck.
15793258 2005 Genetic variations in the gene encoding ELMO1 are associated with susceptibility to diabetic nephropathy.
15723800 2005 A Steric-inhibition model for regulation of nucleotide exchange via the Dock180 family of GEFs.
15700267 2005 C-terminal SH3 domain of CrkII regulates the assembly and function of the DOCK180/ELMO Rac-GEF.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15247908 2004 PH domain of ELMO functions in trans to regulate Rac activation via Dock180.
14737186 2004 HIV-1 Nef binds the DOCK2-ELMO1 complex to activate rac and inhibit lymphocyte chemotaxis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14638695 2004 Dock180 and ELMO1 proteins cooperate to promote evolutionarily conserved Rac-dependent cell migration.
12879077 2003 RhoG activates Rac1 by direct interaction with the Dock180-binding protein Elmo.
12829596 2003 DOCK2 regulates Rac activation and cytoskeletal reorganization through interaction with ELMO1.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12134158 2002 Unconventional Rac-GEF activity is mediated through the Dock180-ELMO complex.
12029088 2002 Identification of novel SH3 domain ligands for the Src family kinase Hck. Wiskott-Aldrich syndrome protein (WASP), WASP-interacting protein (WIP), and ELMO1.
11595183 2001 CED-12/ELMO, a novel member of the CrkII/Dock180/Rac pathway, is required for phagocytosis and cell migration.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
9179496 1997 Construction and characterization of human brain cDNA libraries suitable for analysis of cDNA clones encoding relatively large proteins.