Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.69
PubTator Score 9.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 2.4e-11
ovarian cancer 8491 3.9e-09
medulloblastoma 1524 4.9e-09
atypical teratoid / rhabdoid tumor 4369 6.1e-09
non-small cell lung cancer 2798 8.6e-08
ulcerative colitis 2087 1.8e-07
lung carcinoma 2844 2.2e-07
posterior fossa group B ependymoma 1530 2.0e-06
adrenocortical carcinoma 1427 2.7e-06
medulloblastoma, large-cell 6234 2.9e-06
tuberculosis and treatment for 3 months 327 7.2e-06
lung adenocarcinoma 2714 1.0e-05
primitive neuroectodermal tumor 3031 1.1e-05
pituitary cancer 1972 1.8e-05
interstitial cystitis 2299 1.2e-04
chronic lymphosyte leukemia 232 7.3e-04
glioblastoma 5572 9.6e-04
pediatric high grade glioma 2712 1.1e-03
COPD 116 1.2e-03
osteosarcoma 7933 1.6e-03
Pick disease 1893 2.9e-03
pancreatic ductal adenocarcinoma liver metastasis 1795 3.7e-03
non diabetic and post-ischemic heart failure 200 6.1e-03
active Crohn's disease 918 7.7e-03
astrocytic glioma 2241 1.0e-02
invasive ductal carcinoma 2950 1.0e-02
non primary Sjogren syndrome sicca 840 1.1e-02
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.2e-02
hepatocellular carcinoma 550 1.4e-02
mucosa-associated lymphoid tissue lymphoma 480 1.4e-02
oligodendroglioma 2849 2.6e-02
spina bifida 1064 2.9e-02
pancreatic carcinoma 567 3.3e-02
pancreatic cancer 2300 3.3e-02
subependymal giant cell astrocytoma 2287 3.6e-02
Breast cancer 3098 3.7e-02
type II diabetes mellitus and post-ischemic heart failure 89 3.7e-02
interstitial lung disease 292 4.2e-02

Expression

  Differential Expression (38)

Disease log2 FC p
hepatocellular carcinoma -1.200 1.4e-02
pancreatic cancer 1.700 3.3e-02
interstitial lung disease -1.900 4.2e-02
astrocytic glioma 2.000 1.0e-02
oligodendroglioma -1.300 2.6e-02
osteosarcoma 2.418 1.6e-03
chronic lymphosyte leukemia -1.100 7.3e-04
posterior fossa group B ependymoma -2.400 2.0e-06
glioblastoma -2.300 9.6e-04
medulloblastoma -3.800 4.9e-09
non diabetic and post-ischemic heart fai... -1.300 6.1e-03
type II diabetes mellitus and post-ische... -1.300 3.7e-02
atypical teratoid / rhabdoid tumor -4.100 6.1e-09
medulloblastoma, large-cell -4.500 2.9e-06
primitive neuroectodermal tumor -3.100 1.1e-05
acute quadriplegic myopathy 2.597 2.4e-11
adrenocortical carcinoma -2.049 2.7e-06
pancreatic ductal adenocarcinoma liver m... -2.049 3.7e-03
tuberculosis and treatment for 3 months -3.200 7.2e-06
non-small cell lung cancer -1.335 8.6e-08
intraductal papillary-mucinous carcinoma... -1.500 1.2e-02
active Crohn's disease 1.376 7.7e-03
Breast cancer 3.100 3.7e-02
interstitial cystitis 1.500 1.2e-04
pediatric high grade glioma -1.700 1.1e-03
non primary Sjogren syndrome sicca -1.500 1.1e-02
pancreatic carcinoma 1.700 3.3e-02
subependymal giant cell astrocytoma 1.095 3.6e-02
lung adenocarcinoma -1.100 1.0e-05
invasive ductal carcinoma 1.769 1.0e-02
COPD 1.300 1.2e-03
lung carcinoma -1.300 2.2e-07
spina bifida -1.315 2.9e-02
Pick disease 1.900 2.9e-03
mucosa-associated lymphoid tissue lympho... 1.717 1.4e-02
ulcerative colitis 2.200 1.8e-07
ovarian cancer -2.500 3.9e-09
pituitary cancer -2.700 1.8e-05

Gene RIF (13)

PMID Text
26007630 multiple myeloma risk allele harbours a Thr298Ala missense variant in an ELL2 domain required for transcription elongation
25238757 Loss of ELL2 in B cells results in decreased Igh secretory mRNA and decreased expression of Ig light chain plus genes involved in the unfolded protein response like XBP1, ATF6, BiP, cyclin B2, OcaB (BOB1, Pou2af1).
25058508 Tax transactivates the ELL2 promoter in HTLV-1-infected T-cells.
24565118 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
24367103 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23087374 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22483617 Prostratin and HMBA, two well-studied activators of HIV transcription and latency, enhance ELL2 accumulation and SECs formation largely through decreasing Siah1 expression and ELL2 polyubiquitination.
21360054 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
21242887 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
20471948 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19749764 ELL2 addition regulates mRNA processing by enhancing poly(A) site choice and exon splice-site skipping

AA Sequence

MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIP      1 - 70
KNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQ     71 - 140
AEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRV    141 - 210
IHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDR    211 - 280
RSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNG    281 - 350
HLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDS    351 - 420
IYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDL    421 - 490
KREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHA    491 - 560
RMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE    561 - 630
FDQQQAESWS                                                                631 - 640
//

Text Mined References (26)

PMID Year Title
26007630 2015 Variants in ELL2 influencing immunoglobulin levels associate with multiple myeloma.
25238757 2014 Transcription elongation factor ELL2 drives Ig secretory-specific mRNA production and the unfolded protein response.
25058508 2014 The transcription elongation factor ELL2 is specifically upregulated in HTLV-1-infected T-cells and is dependent on the viral oncoprotein Tax.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251033 2013 HIV-1 Tat recruits transcription elongation factors dispersed along a flexible AFF4 scaffold.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22483617 2012 The ubiquitin ligase Siah1 controls ELL2 stability and formation of super elongation complexes to modulate gene transcription.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20471948 2010 HIV-1 Tat and host AFF4 recruit two transcription elongation factors into a bifunctional complex for coordinated activation of HIV-1 transcription.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20159561 2010 AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19749764 2009 Transcription elongation factor ELL2 directs immunoglobulin secretion in plasma cells by stimulating altered RNA processing.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446457 2003 ELL-associated factor 2 (EAF2), a functional homolog of EAF1 with alternative ELL binding properties.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11418481 2001 EAF1, a novel ELL-associated factor that is delocalized by expression of the MLL-ELL fusion protein.
9108030 1997 ELL2, a new member of an ELL family of RNA polymerase II elongation factors.