Property Summary

NCBI Gene PubMed Count 39
PubMed Score 261.19
PubTator Score 107.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Malignant neoplasm of breast 63
Disease Target Count P-value
malignant mesothelioma 3163 3.0e-06
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 4.363 2.2
Specific language impairment 31 3.185 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.200 3.0e-06

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (13)

PMID Text
27009366 This work reveals a previously unrecognized function for ELL as an E3 ubiquitin ligase for c-Myc and a potential tumour suppressor.
26188510 The Tax oncogene enhances ELL incorporation into p300 and P-TEFb containing protein complexes to activate transcription.
24344198 eleven-nineteen lysine-rich leukemia protein enhanced E2F1 deacetylation via recruitment of histone deacetylase 1
24127601 ELL is an essential player for RNA Pol II restart during cellular DNA damage response.
22895430 Studies indicate that the super elongation complex (SEC) consisting of ELL, P-TEFb (CDK9) and MLL required for rapid transcriptional induction in the presence or absence of paused RNA polymerase II (Pol II).
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22355797 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
22252557 ELL has an early and essential role during rapid high-amplitude gene expression that is required for both Pol II pause site entry and release
20471949 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
20166137 Our findings suggest that ELL and HIF-1alpha are binding partners and can modulate the functions of each other in hypoxia.
19447890 ELL (Eleven-Nineteen Lysine-rich Leukemia) acts as a transcription factor for direct thrombospondin-1 regulation
16086288 In the Acute Myeloid Leukemia patients, detected MLL rearrangements consisting of MLL/AF6, MLL/AF9, MLL/AF17 , MLL/ELL and MLL partial tandem duplication. MLL rearrangement include chromosome translocation and partial tandem duplication.
9765201 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb

AA Sequence

MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQGHISIPQPDC      1 - 70
PAEARTFSFYLSNIGRDNPQGSFDCIQQYVSSHGEVHLDCLGSIQDKITVCATDDSYQKARQSMAQAEEE     71 - 140
TRSRSAIVIKAGGRYLGKKVQFRKPAPGATDAVPSRKRATPINLASAIRKSGASAVSGGSGVSQRPFRDR    141 - 210
VLHLLALRPYRKAELLLRLQKDGLTQADKDALDGLLQQVANMSAKDGTCTLQDCMYKDVQKDWPGYSEGD    211 - 280
QQLLKRVLVRKLCQPQSTGSLLGDPAASSPPGERGRSASPPQKRLQPPDFIDPLANKKPRISHFTQRAQP    281 - 350
AVNGKLGVPNGREALLPTPGPPASTDTLSSSTHLPPRLEPPRAHDPLADVSNDLGHSGRDCEHGEAAAPA    351 - 420
PTVRLGLPLLTDCAQPSRPHGSPSRSKPKKKSKKHKDKERAAEDKPRAQLPDCAPATHATPGAPADTPGL    421 - 490
NGTCSVSSVPTSTSETPDYLLKYAAISSSEQRQSYKNDFNAEYSEYRDLHARIERITRRFTQLDAQLRQL    491 - 560
SQGSEEYETTRGQILQEYRKIKKTNTNYSQEKHRCEYLHSKLAHIKRLIAEYDQRQLQAWP             561 - 621
//

Text Mined References (46)

PMID Year Title
27009366 2016 ELL targets c-Myc for proteasomal degradation and suppresses tumour growth.
26188510 2015 The Tax oncogene enhances ELL incorporation into p300 and P-TEFb containing protein complexes to activate transcription.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24344198 2014 ELL inhibits E2F1 transcriptional activity by enhancing E2F1 deacetylation via recruitment of histone deacetylase 1.
24127601 2013 ELL, a novel TFIIH partner, is involved in transcription restart after DNA repair.
23932780 2013 The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23535729 2013 Large-scale genotyping identifies 41 new loci associated with breast cancer risk.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22252557 2012 ELL facilitates RNA polymerase II pause site entry and release.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
20471948 2010 HIV-1 Tat and host AFF4 recruit two transcription elongation factors into a bifunctional complex for coordinated activation of HIV-1 transcription.
20166137 2010 ELL is an HIF-1alpha partner that regulates and responds to hypoxia response in PC3 cells.
20159561 2010 AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19819239 2009 The interaction between EAP30 and ELL is modulated by MCM2.
19447890 2009 Elongation factor ELL (Eleven-Nineteen Lysine-rich Leukemia) acts as a transcription factor for direct thrombospondin-1 regulation.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17395368 2007 FB1, an E2A fusion partner in childhood leukemia, interacts with U19/EAF2 and inhibits its transcriptional activity.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16086288 2005 [Application of reverse transcription-multiplex nested PCR to detect MLL rearrangement in AML-M4/M5].
16006523 2005 ELL-associated factors 1 and 2 are positive regulators of RNA polymerase II elongation factor ELL.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12773566 2003 Molecular basis of p53 functional inactivation by the leukemic protein MLL-ELL.
12686606 2003 ELL and EAF1 are Cajal body components that are disrupted in MLL-ELL leukemia.
12676794 2003 The RNA polymerase II elongation complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446457 2003 ELL-associated factor 2 (EAF2), a functional homolog of EAF1 with alternative ELL binding properties.
11463848 2001 The elongation domain of ELL is dispensable but its ELL-associated factor 1 interaction domain is essential for MLL-ELL-induced leukemogenesis.
11418481 2001 EAF1, a novel ELL-associated factor that is delocalized by expression of the MLL-ELL fusion protein.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10995463 2000 Retrovirus-mediated gene transfer of MLL-ELL transforms primary myeloid progenitors and causes acute myeloid leukemias in mice.
10490622 1999 hnRNP U inhibits carboxy-terminal domain phosphorylation by TFIIH and represses RNA polymerase II elongation.
10419521 1999 Cloning and characterization of the EAP30 subunit of the ELL complex that confers derepression of transcription by RNA polymerase II.
10358050 1999 Physical interaction and functional antagonism between the RNA polymerase II elongation factor ELL and p53.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9556611 1998 Identification and purification of the Holo-ELL complex. Evidence for the presence of ELL-associated proteins that suppress the transcriptional inhibitory activity of ELL.
9268387 1997 Structure and function of RNA polymerase II elongation factor ELL. Identification of two overlapping ELL functional domains that govern its interaction with polymerase and the ternary elongation complex.
8596958 1996 An RNA polymerase II elongation factor encoded by the human ELL gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8016121 1994 Two cellular proteins that bind to wild-type but not mutant p53.
7991593 1994 Cloning of ELL, a gene that fuses to MLL in a t(11;19)(q23;p13.1) in acute myeloid leukemia.