Property Summary

NCBI Gene PubMed Count 22
PubMed Score 9.77
PubTator Score 17.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.700 2.2e-05
osteosarcoma 2.280 3.3e-07
medulloblastoma, large-cell 1.200 2.7e-05
juvenile dermatomyositis 1.325 2.4e-08
primary pancreatic ductal adenocarcinoma 1.173 1.6e-02
tuberculosis and treatment for 6 months 1.400 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 7.5e-03
lung cancer 1.100 2.4e-02
primary Sjogren syndrome 1.400 9.6e-03
Alzheimer's disease 1.200 3.7e-02
Pick disease 1.600 8.5e-07
progressive supranuclear palsy -1.100 4.8e-03
ulcerative colitis 1.300 9.5e-06
ovarian cancer 2.400 2.2e-09
pancreatic cancer 1.100 8.1e-03

Gene RIF (6)

PMID Text
26938874 CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA
26028036 ELK4 is overexpressed in melanoma and knocking down the ELK4 or CDK2 expression significantly attenuated the malignant phenotype of melanoma cells
22719019 Data suggest that chimeric SLC45A3-ELK4 controls prostate cancer cell proliferation, and the chimera level correlates with prostate cancer disease progression.
19136943 SLC45A3-ELK4 may represent the first description of a recurrent RNA chimaeric transcript specific to prostate cancer that does not have a detectable DNA aberration
18469865 ELK4 is a direct androgen receptor target in prostate cancer cells. Androgens may thus contribute to the growth of prostate cancer via influencing ELK4 levels
11846562 Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex

AA Sequence

MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKN      1 - 70
IIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRND     71 - 140
YIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISI    141 - 210
GPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDT    211 - 280
DIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPT    281 - 350
ASLTPAFFSQTPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST    351 - 420
PGPFSPDLQKT                                                               421 - 431
//

Text Mined References (25)

PMID Year Title
26938874 2016 Role of CTCF in Regulating SLC45A3-ELK4 Chimeric RNA.
26028036 2016 Cyclin-dependent kinase 2 (CDK2) is a key mediator for EGF-induced cell transformation mediated through the ELK4/c-Fos signaling pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22722849 2012 SIRT7 links H3K18 deacetylation to maintenance of oncogenic transformation.
22719019 2012 Chimeric transcript generated by cis-splicing of adjacent genes regulates prostate cancer cell proliferation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19136943 2009 Transcriptome sequencing to detect gene fusions in cancer.
18469865 2008 Identification of ETS-like transcription factor 4 as a novel androgen receptor target in prostate cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11846562 2001 Crystal structure of a ternary SAP-1/SRF/c-fos SRE DNA complex.
11406578 2001 The B-box dominates SAP-1-SRF interactions in the structure of the ternary complex.
10473620 1999 Activation of the protein kinase ERK5/BMK1 by receptor tyrosine kinases. Identification and characterization of a signaling pathway to the nucleus.
10022839 1999 Id helix-loop-helix proteins inhibit nucleoprotein complex formation by the TCF ETS-domain transcription factors.
9734357 1998 Structures of SAP-1 bound to DNA targets from the E74 and c-fos promoters: insights into DNA sequence discrimination by Ets proteins.
9644975 1998 Ets transcription factors: nuclear effectors of the Ras-MAP-kinase signaling pathway.
9570133 1997 The ETS-domain transcription factor family.
9235954 1997 p38-2, a novel mitogen-activated protein kinase with distinct properties.
8575773 1995 Locations of the ets subfamily members net, elk1, and sap1 (ELK3, ELK1, and ELK4) on three homologous regions of the mouse and human genomes.
8293474 1994 Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element.
7851904 1994 Mapping of the human SAP1 (SRF accessory protein 1) gene and SAP2, a gene encoding a related protein, to chromosomal bands 1q32 and 12q23, respectively.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7540136 1995 Comparative analysis of the ternary complex factors Elk-1, SAP-1a and SAP-2 (ERP/NET).
1339307 1992 Characterization of SAP-1, a protein recruited by serum response factor to the c-fos serum response element.