Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.86
PubTator Score 170.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
chronic lymphocytic leukemia -1.043 1.1e-03
psoriasis 2.000 6.3e-04
glioblastoma 2.100 2.3e-03
osteosarcoma 1.378 3.3e-04
posterior fossa group A ependymoma 1.500 7.3e-05
sonic hedgehog group medulloblastoma 1.300 1.4e-02
cystic fibrosis 1.145 3.2e-05
astrocytoma 1.800 4.8e-02
atypical teratoid / rhabdoid tumor 1.200 1.6e-04
medulloblastoma, large-cell 1.100 6.0e-05
Duchenne muscular dystrophy 1.745 2.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.587 8.5e-03
juvenile dermatomyositis 1.476 1.4e-07
primary pancreatic ductal adenocarcinoma 1.424 3.4e-03
lung cancer -2.600 1.5e-05
active Crohn's disease 1.070 3.8e-02
ulcerative colitis 2.600 9.1e-07
interstitial cystitis 1.300 8.4e-05
pediatric high grade glioma 2.100 1.0e-04
pilocytic astrocytoma 2.200 6.3e-07
primary Sjogren syndrome 1.200 3.0e-04
aldosterone-producing adenoma -1.353 1.8e-02
nasopharyngeal carcinoma -1.100 5.0e-03
gastric carcinoma 1.300 3.5e-02
ovarian cancer -1.100 2.6e-02
pancreatic cancer 1.300 4.9e-04
dermatomyositis 1.400 1.0e-02

MLP Assay (13)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (7)

PMID Text
26637400 results suggest that ELK3 plays a positive role in the metastasis of BC cells by indirectly regulating MT1-MMP expression
25401928 The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response.
24719561 ELK3 plays a negative role of VEGF-induced angiogenesis through indirectly inhibiting ETS-1 function.
20427288 Net and HIF1alpha are components of distinct signaling pathways that are intricately linked
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18832796 These findings suggested that loss of Net repression could augment c-fos expression and further trigger neoplastic cell proliferation, which was involved in the pathogenesis of pancreatic cancer.
18316589 the Ras-Net (Elk-3) pathway involves microtubules and is inhibited by pyrazoles

AA Sequence

MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKN      1 - 70
IIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHS     71 - 140
GLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVSLPSTSEAAAA    141 - 210
SAFLASSVSAKISSLMLPNAASISSASPFSSRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGS    211 - 280
KTKSPSLPPKAKKPKGLEISAPPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSI    281 - 350
HFWSSLSPVAPLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS                 351 - 407
//

Text Mined References (28)

PMID Year Title
26637400 2015 ELK3 Expression Correlates With Cell Migration, Invasion, and Membrane Type 1-Matrix Metalloproteinase Expression in MDA-MB-231 Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
25401928 2014 The oncogenic MicroRNA Hsa-miR-155-5p targets the transcription factor ELK3 and links it to the hypoxia response.
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24719561 2014 ELK3 suppresses angiogenesis by inhibiting the transcriptional activity of ETS-1 on MT1-MMP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20427288 2010 Involvement of net and Hif1alpha in distinct yet intricately linked hypoxia-induced signaling pathways.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18832796 2008 Growth inhibitory effect of the ternary complex factor Net on human pancreatic carcinoma cell lines.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18316589 2008 Inhibition of the Ras-Net (Elk-3) pathway by a novel pyrazole that affects microtubules.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12933792 2003 Single-stranded DNA-binding proteins PURalpha and PURbeta bind to a purine-rich negative regulatory element of the alpha-myosin heavy chain gene and control transcriptional and translational regulation of the gene expression. Implications in the repression of alpha-myosin heavy chain during heart failure.
12788937 2003 Transcriptional regulation of the cytosolic chaperonin theta subunit gene, Cctq, by Ets domain transcription factors Elk-1, Sap-1a, and Net in the absence of serum response factor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042694 2000 The ternary complex factor Net contains two distinct elements that mediate different responses to MAP kinase signalling cascades.
10490644 1999 The net repressor is regulated by nuclear export in response to anisomycin, UV, and heat shock.
10369679 1999 Net, a negative Ras-switchable TCF, contains a second inhibition domain, the CID, that mediates repression through interactions with CtBP and de-acetylation.
9644975 1998 Ets transcription factors: nuclear effectors of the Ras-MAP-kinase signaling pathway.
9570133 1997 The ETS-domain transcription factor family.
8918463 1996 Net (ERP/SAP2) one of the Ras-inducible TCFs, has a novel inhibitory domain with resemblance to the helix-loop-helix motif.
7958835 1994 Net, a new ets transcription factor that is activated by Ras.
7851904 1994 Mapping of the human SAP1 (SRF accessory protein 1) gene and SAP2, a gene encoding a related protein, to chromosomal bands 1q32 and 12q23, respectively.
7540136 1995 Comparative analysis of the ternary complex factors Elk-1, SAP-1a and SAP-2 (ERP/NET).