Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.68
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.900 1.2e-07
glioblastoma -2.100 1.7e-03
medulloblastoma -1.700 5.6e-03
medulloblastoma, large-cell -1.500 4.4e-02
pediatric high grade glioma -1.200 4.5e-02
posterior fossa group A ependymoma -1.300 1.9e-03
primitive neuroectodermal tumor -1.500 2.4e-02
psoriasis -1.600 4.8e-40

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MLRLGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDLRLNENKLKAV      1 - 70
LYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTEGMLRGMSRLQFLFVQHNLIE     71 - 140
VVTPTAFSECPSLISIDLSSNRLSRLDGATFASLASLMVCELAGNPFNCECDLFGFLAWLVVFNNVTKNY    141 - 210
DRLQCESPREFAGYPLLVPRPYHSLNAITVLQAKCRNGSLPARPVSHPTPYSTDAQREPDENSGFNPDEI    211 - 280
LSVEPPASSTTDASAGPAIKLHHVTFTSATLVVIIPHPYSKMYILVQYNNSYFSDVMTLKNKKEIVTLDK    281 - 350
LRAHTEYTFCVTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLR    351 - 420
KRRMQEEKQKSVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASIPSMIGEKLPTAKGLEAG    421 - 490
LDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKEVDKVNQIINNCIDALKLDSA    491 - 560
SFLGGGSSSGDPELAFECQSLPAAAAASSATGPGALERPSFLSPPYKESSHHPLQRQLSADAAVTRKTCS    561 - 630
VSSSGSIKSAKVFSLDVPDHPAATGLAKGDSKYIEKGSPLNSPLDRLPLVPAGSGGGSGGGGGIHHLEVK    631 - 700
PAYHCSEHRHSFPALYYEEGADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIW    701 - 770
ERFRPYKKHHREEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL                        771 - 820
//

Text Mined References (12)

PMID Year Title