Property Summary

NCBI Gene PubMed Count 56
PubMed Score 268.30
PubTator Score 187.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -1.800 4.6e-13
interstitial cystitis -1.900 3.1e-02
intraductal papillary-mucinous adenoma (... 1.400 2.6e-03
intraductal papillary-mucinous carcinoma... 1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.300 3.0e-03
lung carcinoma -1.400 3.5e-05
nasopharyngeal carcinoma -1.800 1.4e-03
ovarian cancer 3.000 2.3e-08
pancreatic cancer 1.300 8.4e-04
primary pancreatic ductal adenocarcinoma 1.626 1.1e-02
psoriasis 1.700 1.9e-61
spina bifida -2.275 4.0e-02
urothelial carcinoma -1.700 1.7e-02

Gene RIF (39)

AA Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT      1 - 70
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII     71 - 140
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS    141 - 210
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR    211 - 280
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL    281 - 350
VYKFGKNSSGWKEEEVLQSRN                                                     351 - 371
//

Text Mined References (68)

PMID Year Title