Property Summary

NCBI Gene PubMed Count 49
PubMed Score 243.12
PubTator Score 187.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.700 1.7e-02
primary pancreatic ductal adenocarcinoma 1.626 1.1e-02
intraductal papillary-mucinous adenoma (... 1.400 2.6e-03
intraductal papillary-mucinous carcinoma... 1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 2.300 3.0e-03
pancreatic cancer 1.300 8.4e-04
interstitial cystitis -3.300 2.8e-04
nasopharyngeal carcinoma -1.800 1.4e-03
lung carcinoma -1.400 3.5e-05
spina bifida -2.275 4.0e-02
Breast cancer -1.800 4.6e-13
ovarian cancer 3.000 2.3e-08
psoriasis 1.700 1.9e-61

 GO Component (2)

Gene RIF (32)

PMID Text
26920025 ELF3 is a novel transcriptional repressor of estrogen receptor alpha in breast cancer cells.
26804919 ELF3 is a frequently mutated tumor suppressor gene of periampullary tumors.
26185364 suggest that ESE-1 may play a role in regulating airway inflammation by regulating ICAM-1 expression
25926267 our data suggested that ESE1/ELF3 may promote the UC progression via accelerating NF-kappaB activation and thus facilitating IEC apoptosis.
24971534 ESE-1 actS as an upstream effector to regulate OCT4 transcription in NCCIT pluripotent embryonic carcinoma cells.
24874735 data identify Elf3 as a pivotal driver for beta-catenin signaling in CRC, and highlight potential prognostic and therapeutic significance of Elf3 in CRC.
24694612 data suggest that polyomavirus enhancer activator 3 and epithelium-specific transcription factor-1 may play important roles in pluri potent and tumorigenic embryonic carcinoma cells.
24374157 ELF3 is a candidate transcriptional regulator involved in human urothelial cytodifferentiation.
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of E74-like factor 3 (ELF3) expression as compared to untreated control
23687337 The concordant upregulation of ESE1/ELF3 and NF-kappaB in human prostate tumors.
23435425 The physical interaction between ELF3 and androgen receptor (AR) inhibits the recruitment of AR to specific androgen response elements within target gene promoters.
23329352 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
22993316 ELF3 and CEA expression showed statistically significant differences among four lymph node groups: lymph nodes from patients with colorectal cancer categorized into three Dukes' stages and LNs from patients with ulcerative colitis.
22158614 a novel role for ELF3 as a procatabolic factor that may contribute to cartilage remodeling and degradation by regulating MMP13 gene transcription.
22082156 Knockdown of E74-like factor 3 (ets domain transcription factor, epithelial-specific; ELF3) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21871131 ESE-1 contains signal sequences that play a critical role in regulating its subcellular localization and function, and that an intact SAR domain mediates mammary epithelial cell transformation exclusively in the cytoplasm
19074849 activation of ESE-1 via enhanced nuclear translocation mediates tolfenamic acid-induced EGR-1 expression, which plays a critical role in the activation of apoptosis
18475289 ESE-1 and ESE-3 play an important role in airway inflammation.
18302674 ESE-1 negatively regulates the invasion of oral squamous cell carcinoma via transcriptional suppression of MMP-9.
18044710 Intracellular ESE-1 staining in chondrocytes in cartilage from patients with osteoarthritis, but not in normal cartilage, further suggests a fundamental role for ESE-1 in cartilage degeneration and suppression of repair.
17491012 ESE-1 functions are coordinately regulated by Pak1 phosphorylation and beta-TrCP-dependent ubiquitin-proteasome pathways.
17148437 AT-hook domain, as well as serine- and aspartic acid-rich domain but not the pointed domain, is necessary for Elf3 activation of promoter activity.
17060315 the induction of claudin7 expression by ELF3 appears critical to the formation of the epithelial structures in biphasic synovial sarcoma
15169914 stably expressed green fluorescent protein-ESE-1 transforms MCF-12A human mammary epithelial cells; and the ESE-1 SAR domain, acting in the cytoplasm, is necessary and sufficient to mediate this transformation
15075319 activity of ESE-1 is positively and negatively modulated by other interacting proteins including Ku70, Ku86, p300, and CBP.
14767472 ESX expression alone confers a transformed and in vitro metastatic phenotype to otherwise normal MCF-12A cells
14715662 results support a role for the ETS factor ESE-1 as a novel transcriptional regulator of angiopoietin-1 gene regulation in the setting of inflammation
14582709 ERT mediates the expression of TGF-beta RII, and the transcriptional inhibition of ets-related transcription factor could be a one of the mechanisms of colonic carcinogenesis
12624109 Ese-1 binds with Skn-1a in human cells
12414801 co-ordinate activation and binding of ESE-1, Sp1, and NF-kappaB to the MIP-3alpha promoter is required for maximal gene expression by cytokine-stimulated Caco-2 human intestinal epithelial cells.
12242338 ESX regulates HER2 expression by binding to DRIP130
12032832 ErbB2 activation of ESX gene expression

AA Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT      1 - 70
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII     71 - 140
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS    141 - 210
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR    211 - 280
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL    281 - 350
VYKFGKNSSGWKEEEVLQSRN                                                     351 - 371
//

Text Mined References (61)

PMID Year Title
26977885 2016 Protein Kinase C? Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.
26920025 2016 A transcriptional repressive role for epithelial-specific ETS factor ELF3 on oestrogen receptor alpha in breast cancer cells.
26804919 2016 Ampullary Cancers Harbor ELF3 Tumor Suppressor Gene Mutations and Exhibit Frequent WNT Dysregulation.
26185364 2015 Epithelium-Specific Ets-Like Transcription Factor 1, ESE-1, Regulates ICAM-1 Expression in Cultured Lung Epithelial Cell Lines.
25926267 2015 Epithelial-specific ETS-1 (ESE1/ELF3) regulates apoptosis of intestinal epithelial cells in ulcerative colitis via accelerating NF-?B activation.
24971534 2014 Transcriptional regulation of OCT4 by the ETS transcription factor ESE-1 in NCCIT human embryonic carcinoma cells.
24874735 2014 Elf3 drives ?-catenin transactivation and associates with poor prognosis in colorectal cancer.
24694612 2014 Differential expression of ETS family transcription factors in NCCIT human embryonic carcinoma cells upon retinoic acid-induced differentiation.
24374157 2014 Identification of ELF3 as an early transcriptional regulator of human urothelium.
23687337 2013 ETS transcription factor ESE1/ELF3 orchestrates a positive feedback loop that constitutively activates NF-?B and drives prostate cancer progression.
23435425 2014 ELF3 is a repressor of androgen receptor action in prostate cancer cells.
23329352 2013 Frequent copy number gains at 1q21 and 1q32 are associated with overexpression of the ETS transcription factors ETV3 and ELF3 in breast cancer irrespective of molecular subtypes.
22993316 2012 Significance of ELF3 mRNA expression for detection of lymph node metastases of colorectal cancer.
22158614 2012 E74-like factor 3 (ELF3) impacts on matrix metalloproteinase 13 (MMP13) transcriptional control in articular chondrocytes under proinflammatory stress.
21871131 2011 Mapping of ESE-1 subdomains required to initiate mammary epithelial cell transformation via a cytoplasmic mechanism.
19074849 2008 ESE-1/EGR-1 pathway plays a role in tolfenamic acid-induced apoptosis in colorectal cancer cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18475289 2008 Regulation of epithelium-specific Ets-like factors ESE-1 and ESE-3 in airway epithelial cells: potential roles in airway inflammation.
18302674 2008 ESE-1 inhibits the invasion of oral squamous cell carcinoma in conjunction with MMP-9 suppression.
18044710 2008 ESE-1 is a potent repressor of type II collagen gene (COL2A1) transcription in human chondrocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17491012 2007 Phosphorylation-dependent regulation of stability and transforming potential of ETS transcriptional factor ESE-1 by p21-activated kinase 1.
17467953 2007 Nine-amino-acid transactivation domain: establishment and prediction utilities.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17148437 2007 Different domains of the transcription factor ELF3 are required in a promoter-specific manner and multiple domains control its binding to DNA.
17060315 2006 Expression of claudin7 is tightly associated with epithelial structures in synovial sarcomas and regulated by an Ets family transcription factor, ELF3.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16307850 2006 Identification of an epithelial-specific enhancer regulating ESX expression.
15794755 2005 The Ets transcription factor ESE-1 mediates induction of the COX-2 gene by LPS in monocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15169914 2004 The ETS transcription factor ESE-1 transforms MCF-12A human mammary epithelial cells via a novel cytoplasmic mechanism.
15075319 2004 Positive and negative modulation of the transcriptional activity of the ETS factor ESE-1 through interaction with p300, CREB-binding protein, and Ku 70/86.
14997048 2004 Partially unspliced and fully spliced ELF3 mRNA, including a new Alu element in human breast cancer.
14767472 2004 ESX induces transformation and functional epithelial to mesenchymal transition in MCF-12A mammary epithelial cells.
14715662 2004 ESE-1 is a novel transcriptional mediator of angiopoietin-1 expression in the setting of inflammation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14582709 2003 Effect of ets-related transcription factor (ERT) on transforming growth factor (TGF)-beta type II receptor gene expression in human cancer cell lines.
12713734 2003 The epithelial-specific ETS transcription factor ESX/ESE-1/Elf-3 modulates breast cancer-associated gene expression.
12682075 2003 Interplay between proximal and distal promoter elements is required for squamous differentiation marker induction in the bronchial epithelium: role for ESE-1, Sp1, and AP-1 proteins.
12624109 2003 Distinct functional interactions of human Skn-1 isoforms with Ese-1 during keratinocyte terminal differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414801 2003 ESE-1, an enterocyte-specific Ets transcription factor, regulates MIP-3alpha gene expression in Caco-2 human colonic epithelial cells.
12242338 2002 External control of Her2 expression and cancer cell growth by targeting a Ras-linked coactivator.
12119107 2002 Human aminopeptidase B (rnpep) on chromosome 1q32.2: complementary DNA, genomic structure and expression.
12032832 2002 ErbB2 activation of ESX gene expression.
11313868 2001 Sequence-specific enhancer binding protein is responsible for the differential expression of ERT/ESX/ELF-3/ESE-1/jen gene in human gastric cancer cell lines: Implication for the loss of TGF-beta type II receptor expression.
11036073 2001 ESE-1 is a novel transcriptional mediator of inflammation that interacts with NF-kappa B to regulate the inducible nitric-oxide synthase gene.
10821850 2000 Divergent hTAFII31-binding motifs hidden in activation domains.
10773884 2000 Dual function of the epithelial specific ets transcription factor, ELF3, in modulating differentiation.
10644990 2000 Over-expression of ERT(ESX/ESE-1/ELF3), an ets-related transcription factor, induces endogenous TGF-beta type II receptor expression and restores the TGF-beta signaling pathway in Hs578t human breast cancer cells.
10391676 1999 Exon 4-encoded acidic domain in the epithelium-restricted Ets factor, ESX, confers potent transactivating capacity and binds to TATA-binding protein (TBP).
10064583 1999 The EH and SH3 domain Ese proteins regulate endocytosis by linking to dynamin and Eps15.
9417054 1998 A novel ets-related transcription factor, ERT/ESX/ESE-1, regulates expression of the transforming growth factor-beta type II receptor.
9395241 1997 A novel epithelial-expressed ETS gene, ELF3: human and murine cDNA sequences, murine genomic organization, human mapping to 1q32.2 and expression in tissues and cancer.
9336459 1997 The expression of a novel, epithelium-specific ets transcription factor is restricted to the most differentiated layers in the epidermis.
9234700 1997 Isolation and characterization of a novel epithelium-specific transcription factor, ESE-1, a member of the ets family.
9129154 1997 ESX: a structurally unique Ets overexpressed early during human breast tumorigenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.