Property Summary

NCBI Gene PubMed Count 16
PubMed Score 96.42
PubTator Score 33.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 1.300 2.3e-04
tuberculosis and treatment for 6 months 1.100 1.9e-06
acute myeloid leukemia 1.100 1.6e-02

Gene RIF (6)

PMID Text
18754678 Affinity of the CAL PDZ domain for the cystic fibrosis transmembrane conductance regulator (CFTR) C-terminus is much weaker than that of the NHERF1/NHERF2 domains, enabling wild-type CFTR to avoid premature entrapment in the lysosomal pathway.
18544453 ELF2 transactivates VCP promoter through binding to two motifs, with a predominant contribution of the upstream one.
17368566 These findings indicate that ELF2/NERF promotes VCP transcription and that ELF2/NERF-VCP pathway might be important for cell survival and proliferation under cytokine stress.
14970218 NERF/ELF-2 physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
11967990 angiopoietin-1 regulates expression of NERF2 and its own receptor in hypoxic cells.

AA Sequence

MTSAVVDSGGTILELSSNGVENQEESEKVSEYPAVIVEPVPSARLEQGYAAQVLVYDDETYMMQDVAEEQ      1 - 70
EVETENVETVEASVHSSNAHCTDKTIEAAEALLHMESPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDV     71 - 140
ITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYL    141 - 210
WEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLLKAASSVRSGKNSSPINCSR    281 - 350
AEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKISTVAVQSVNAGAPLI    351 - 420
TSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGSGSINIVGTP    421 - 490
LAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPAD    491 - 560
GNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK                                         561 - 593
//

Text Mined References (25)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674970 2009 Critical role for GATA3 in mediating Tie2 expression and function in large vessel endothelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18754678 2008 The relative binding affinities of PDZ partners for CFTR: a biochemical basis for efficient endocytic recycling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18544453 2008 E74-like factor 2 transactivates valosin-containing protein gene, a gene involved in cancer growth.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17368566 2007 E74-like factor 2 regulates valosin-containing protein expression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14970218 2004 Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
11967990 2002 NERF2, a member of the Ets family of transcription factors, is increased in response to hypoxia and angiopoietin-1: a potential mechanism for Tie2 regulation during hypoxia.
10207087 1999 Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.
9001422 1997 Elf-2, a rhombotin-2 binding ets transcription factor: discovery and potential role in T cell leukemia.
8756667 1996 Characterization of NERF, a novel transcription factor related to the Ets factor ELF-1.