Property Summary

NCBI Gene PubMed Count 39
PubMed Score 5.73
PubTator Score 69.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.800 2.1e-03
Waldenstrons macroglobulinemia 1.021 2.5e-02
astrocytoma 1.500 9.2e-03
posterior fossa group B ependymoma 1.300 1.6e-05
oligodendroglioma 1.100 1.3e-02
glioblastoma 1.700 6.3e-04
juvenile dermatomyositis 1.040 4.7e-10
intraductal papillary-mucinous adenoma (... 1.200 7.4e-03
lung cancer -1.400 3.8e-03
pediatric high grade glioma 1.100 2.1e-04
pilocytic astrocytoma 1.400 2.0e-06
primary Sjogren syndrome 1.300 1.2e-04
aldosterone-producing adenoma -1.060 1.7e-02
subependymal giant cell astrocytoma 1.598 3.9e-03
ovarian cancer 2.000 4.9e-06

Protein-protein Interaction (1)

Gene RIF (17)

PMID Text
26643049 ELF-1 binds an important duplicated GGAA cis-acting element at the OAS1 promoter and in cooperation with RB1 and SP1 recruitment contributes to regulation in response to IFN stimulation.
26553150 ELF1 binding occurs at both TERT promoter mutations in melanoma in vitro such that increased recruitment of GABP is enabled by the spatial architecture of native and novel ETS motifs in the TERT promoter region.
21931859 Expression of FLI-1, ELF-1, and GABP activated the PF4 promoter in HepG2 cells.
21867680 the results indicate that insufficient O-GlcNAc modification prevents Elf-1-mediated transcriptional repression and thereby upregulates Tollip gene expression in intestinal epithelial cells.
21811762 Data suggest that Elf-1 may modulate breast cancer progression to some extent without having an impact on survival of breast cancer patients.
21044949 through a genome-wide association in a Hong Kong Chinese cohort and replication in 2 other Asian populations, identified association of ELF1 with systemic lupus erythematosus
21044949 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20600580 ETS transcription factor ELF1 is an important positive regulator of MEIS1 expression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346215 The expression of Elf-1 and survivin in non-small cell lung cancer is related to differentiation, lymphatic metastasis, clinical stage, and prognosis, and both are positively correlated with microvessel density.
19822898 Data show that VEGFR1 promoter binding sites for ELF-1, CREB and EGR-1/3 play a positive role in gene transcription in endothelial cells.
19624906 The expression levels of both Elf-1 and VEGF were significantly related with tumor differentiation, lymphatic metastasis, clinical stage, and postoperative survival time in non-small cell lung cancer.
18714041 aberrantly increased PP2A in lupus T cells dephosphorylates Elf-1 at Thr-231, resulting in limited expression and binding of the 98 kDa Elf-1 form to the CD3zeta and FcRgamma promoters.
18378679 Elf-1 in combination with Sp1 and GABP reduced FcRgamma promoter activity.
18314487 These results provide new evidence that Elf-1 is involved in transcriptional activation of hPygo2.
16464244 transcriptional regulation of the LAT gene, including the discovery that the Ets transcription factor Elf-1 may play a central role in its expression
10207087 Includes a comparison of MEF to ELF1.

AA Sequence

MAAVVQQNDLVFEFASNVMEDERQLGDPAIFPAVIVEHVPGADILNSYAGLACVEEPNDMITESSLDVAE      1 - 70
EEIIDDDDDDITLTVEASCHDGDETIETIEAAEALLNMDSPGPMLDEKRINNNIFSSPEDDMVVAPVTHV     71 - 140
SVTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATTPNISVKKKNKDGKGNTIYL    141 - 210
WEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKV    211 - 280
EGQRLVYQFKEMPKDLIYINDEDPSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNS    281 - 350
KAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRT    351 - 420
IQAPTQVPVVVSPRNQQLHTVTLQTVPLTTVIASTDPSAGTGSQKFILQAIPSSQPMTVLKENVMLQSQK    421 - 490
AGSPPSIVLGPAQVQQVLTSNVQTICNGTVSVASSPSFSATAPVVTFSPRSSQLVAHPPGTVITSVIKTQ    491 - 560
ETKTLTQEVEKKESEDHLKENTEKTEQQPQPYVMVVSSSNGFTSQVAMKQNELLEPNSF               561 - 619
//

Text Mined References (49)

PMID Year Title
26643049 2015 The hematopoietic regulator, ELF-1, enhances the transcriptional response to Interferon-? of the OAS1 anti-viral gene.
26553150 2016 An interaction proteomics survey of transcription factor binding at recurrent TERT promoter mutations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21931859 2011 Multiple ETS family proteins regulate PF4 gene expression by binding to the same ETS binding site.
21867680 2011 Transcription of the Tollip gene is elevated in intestinal epithelial cells through impaired O-GlcNAcylation-dependent nuclear translocation of the negative regulator Elf-1.
21811762 2011 Protein expression of the Ets transcription factor Elf-1 in breast cancer cells is negatively correlated with histological grading, but not with clinical outcome.
21269460 2011 Initial characterization of the human central proteome.
21044949 2011 ELF1 is associated with systemic lupus erythematosus in Asian populations.
20600580 2010 Identification of E74-like factor 1 (ELF1) as a transcriptional regulator of the Hox cofactor MEIS1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20346215 2010 Expression of Elf-1 and survivin in non-small cell lung cancer and their relationship to intratumoral microvessel density.
19822898 2009 Differential roles for ETS, CREB, and EGR binding sites in mediating VEGF receptor 1 expression in vivo.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674970 2009 Critical role for GATA3 in mediating Tie2 expression and function in large vessel endothelial cells.
19624906 2009 [Expression and significance of Elf-1 and vascular endothelial growth factor in non-small cell lung cancer].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18714041 2008 PP2A dephosphorylates Elf-1 and determines the expression of CD3zeta and FcRgamma in human systemic lupus erythematosus T cells.
18692240 2009 Physical and functional interactions between hematopoietic cell-specific ETS transcription factors and homeodomain proteins.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18378679 2008 Cooperative regulation of Fc receptor gamma-chain gene expression by multiple transcription factors, including Sp1, GABP, and Elf-1.
18314487 2008 Oncogenic activation of the human Pygopus2 promoter by E74-like factor-1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17652178 2007 Genome-wide analyses reveal properties of redundant and specific promoter occupancy within the ETS gene family.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16464244 2006 Regulation of the human LAT gene by the Elf-1 transcription factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14970218 2004 Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12727645 2003 Activation of the Ets transcription factor Elf-1 requires phosphorylation and glycosylation: defective expression of activated Elf-1 is involved in the decreased TCR zeta chain gene expression in patients with systemic lupus erythematosus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11884456 2002 Phosphorylation and O-linked glycosylation of Elf-1 leads to its translocation to the nucleus and binding to the promoter of the TCR zeta-chain.
11210123 2000 Splice isoforms of transcription factor Elf-1 affecting its regulatory function in transcription-molecular cloning of rat Elf-1.
10976766 2000 A set of proteins interacting with transcription factor Sp1 identified in a two-hybrid screening.
10377039 1999 Transcription factors Ets1, Ets2, and Elf1 exhibit differential localization in human endometrium across the menstrual cycle and alternate isoforms in cultured endometrial cells.
10207087 1999 Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias.
9668064 1998 Purification and characterization of a protein binding to the SP6 kappa promoter. A potential role for CArG-box binding factor-A in kappa transcription.
9524226 1998 Cloning of a novel human ELF-1-related ETS transcription factor, ELFR, its characterization and chromosomal assignment relative to ELF-1.
8756667 1996 Characterization of NERF, a novel transcription factor related to the Ets factor ELF-1.
8493578 1993 Regulation of the Ets-related transcription factor Elf-1 by binding to the retinoblastoma protein.
7862168 1995 Regulation of cell-type-specific interleukin-2 receptor alpha-chain gene expression: potential role of physical interactions between Elf-1, HMG-I(Y), and NF-kappa B family proteins.
1545787 1992 cis-acting sequences required for inducible interleukin-2 enhancer function bind a novel Ets-related protein, Elf-1.
1527846 1992 A novel Ets-related transcription factor, Elf-1, binds to human immunodeficiency virus type 2 regulatory elements that are required for inducible trans activation in T cells.