Property Summary

NCBI Gene PubMed Count 45
PubMed Score 327.48
PubTator Score 34.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.800 9.1e-03
posterior fossa group B ependymoma -5.200 3.9e-17
oligodendroglioma -1.800 1.9e-02
glioblastoma -3.000 1.0e-02
atypical teratoid / rhabdoid tumor -4.300 2.0e-04
medulloblastoma, large-cell -2.600 2.0e-02
adult high grade glioma -2.500 1.4e-04
pilocytic astrocytoma -2.900 5.8e-07
sonic hedgehog group medulloblastoma 1.100 1.9e-02
lung carcinoma 3.300 6.4e-50
ovarian cancer 1.400 6.8e-04

Gene RIF (28)

PMID Text
25278027 study showed HuD is associated with histological grade, iffuse invasion and nodal metastasis in oral squamous cell carcinoma; it regulates expression of VEGF-A, VEGF-D, MMP-2 and MMP-9
24857657 HuD binds to the APP and BACE1 3' UTRs and increases APP and BACE1 levels.
24036060 Alzheimer's disease brain tissues with elevated neuroserpin protein also showed increased expression of THRbeta1 and HuD
23978401 Phosphomimetic mutation at position Ser 221 increased nuclear HUD export.
23618873 found that p97 and its cofactor, UBXD8, destabilize p21, MKP-1, and SIRT1, three established mRNA targets of the RNA-binding protein HuR, by promoting release of HuR from mRNA
22965691 It can be involved in the pathogenesis of meningiomas in male patients.
22387028 HuD is a pivotal regulator of insulin translation in pancreatic beta cells.
21491091 the endogenous function of ELAVL4 in relation to radiation sensitivity might be the regulation of cell proliferation and death
21282516 Complexes of HuD and Tax epitopes with HLA-A2 are close but imperfect structural mimics: alphabeta T-cell receptor with self antigens is driven to engage HuD in the same traditional binding mode as Tax.
19410329 alterations of nELAV genes could be involved in the onset and/or progression of a subset of neuroendocrine lung tumors.
19410329 Observational study of gene-disease association. (HuGE Navigator)
19252764 We found no evidence for the presence of HuD-specific T cells in the cerebrospinal fluid of patients with Hu-associated paraneoplastic neurological syndromes.
18607064 increased level of mRNA transcripts detected in Small Cell Lung Cancer patients
18587682 Association with rs967582 in a third cohort further implicates ELAVL4 as a Parkinson disease susceptibility gene.
18587682 Observational study of gene-disease association. (HuGE Navigator)
18493953 an unregulated expression of HuD disrupts mossy fiber physiology in adult mice in part by altering the expression and phosphorylation of GAP-43 and the amount of free calmodulin available at the synaptic terminal
18218628 Gene silencing and overexpression of the nELAV member HuD in motoneuronal NSC34 cells indicate that Nova1 mRNA stability and translation are positively and strongly controlled by the nELAV proteins
17577668 HuD plays a role in the post-transcriptional control of GAP-43 mRNA
17234598 Increased expression of HuD in the transgenic hippocampus is associated with a concomitant increase in acetylcholinesterase transcript levels.
17230446 Observational study of gene-disease association. (HuGE Navigator)
16278682 propose that haploinsufficiency of HuD due to chromosome #1p deletion in neuroblastoma selects for cells that amplify N-myc genes
15827745 potential role for ELAVL4 suggested as a modifier gene for age at onset of Parkinson's disease
15735910 Significant T-cell activation occurred in response to 74% of the selected HuD peptides in Hu-positive patients, suggesting a role of cellular immunity during the course of anti-Hu syndrome.
14512168 Ten HuD-derived peptides immunogenic in HLA-A*0201 restriction demonstrate in vitro binding to the HLA molecule, 8 elicit specific cytotoxic T lymphocytes (CTLs) in a murine model, 2 elicit specific human CTLs, and 1 is naturally processed and presented.
12468554 the importance of post-transcriptional mechanisms in regulating AChE expression in differentiating neurons and implicate HuD as a key trans-acting factor in these events
12209604 HuD expression in neuroblastoma
12034726 HuD stabilizes the GAP-43 mRNA through a mechanism that is dependent on the length of the poly(A) tail and involves changes in its affinity for the mRNA
11803489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG      1 - 70
EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP     71 - 140
KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA    141 - 210
NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACPPRFSPITIDG    211 - 280
MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE    281 - 350
AAMAIASLNGYRLGDRVLQVSFKTNKAHKS                                            351 - 380
//

Text Mined References (48)

PMID Year Title
25278027 2014 HuD promotes progression of oral squamous cell carcinoma.
24857657 2014 HuD regulates coding and noncoding RNA to induce APP?A? processing.
24036060 2013 Neuroserpin up-regulation in the Alzheimer's disease brain is associated with elevated thyroid hormone receptor-?1 and HuD expression.
23978401 2013 Domain-specific phosphomimetic mutation allows dissection of different protein kinase C (PKC) isotype-triggered activities of the RNA binding protein HuR.
23618873 2013 The p97-UBXD8 complex destabilizes mRNA by promoting release of ubiquitinated HuR from mRNP.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22965691 2013 Reduced expression of ELAVL4 in male meningioma patients.
22387028 2012 RNA-binding protein HuD controls insulin translation.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
21491091 2011 Identification of ELAVL4 as a modulator of radiation sensitivity in A549 non-small cell lung cancer cells.
21282516 2011 Conformational melding permits a conserved binding geometry in TCR recognition of foreign and self molecular mimics.
19410329 2010 Molecular analysis of the HuD gene in neuroendocrine lung cancers.
19252764 2009 No evidence for the presence of HuD-specific T cells in the cerebrospinal fluid of patients with Hu-associated paraneoplastic neurological syndromes.
18607064 2008 Molecular detection of neuron-specific ELAV-like-positive cells in the peripheral blood of patients with small-cell lung cancer.
18587682 2008 Replication of association between ELAVL4 and Parkinson disease: the GenePD study.
18493953 2008 Alterations in mossy fiber physiology and GAP-43 expression and function in transgenic mice overexpressing HuD.
18218628 2008 Post-transcriptional regulation of neuro-oncological ventral antigen 1 by the neuronal RNA-binding proteins ELAV.
17577668 2007 Coordinated expression of HuD and GAP-43 in hippocampal dentate granule cells during developmental and adult plasticity.
17234598 2007 The RNA-binding protein HuD binds acetylcholinesterase mRNA in neurons and regulates its expression after axotomy.
17230446 2007 ELAVL4, PARK10, and the Celts.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16508003 2006 CARM1 regulates proliferation of PC12 cells by methylating HuD.
16278682 2006 Loss of one HuD allele on chromosome #1p selects for amplification of the N-myc proto-oncogene in human neuroblastoma cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15827745 2005 Association between the neuron-specific RNA-binding protein ELAVL4 and Parkinson disease.
15735910 2005 T cell response to Hu-D peptides in patients with anti-Hu syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358174 2004 TAP/NXF1, the primary mRNA export receptor, specifically interacts with a neuronal RNA-binding protein HuD.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512168 2003 Peptides derived from the onconeural HuD protein can elicit cytotoxic responses in HHD mouse and human.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12468554 2003 Post-transcriptional regulation of acetylcholinesterase mRNAs in nerve growth factor-treated PC12 cells by the RNA-binding protein HuD.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12235292 2002 Visualization of translated tau protein in the axons of neuronal P19 cells and characterization of tau RNP granules.
12209604 2002 Novel products of the HUD, HUC, NNP-1 and alpha-internexin genes identified by autologous antibody screening of a pediatric neuroblastoma library.
12034726 2002 Poly(A) tail length-dependent stabilization of GAP-43 mRNA by the RNA-binding protein HuD.
11803489 2001 Evaluation of the ELOVL4 gene in patients with age-related macular degeneration.
11175903 2001 Structural basis for recognition of AU-rich element RNA by the HuD protein.
10848602 2000 HuD RNA recognition motifs play distinct roles in the formation of a stable complex with AU-rich RNA.
10710437 2000 RNA-binding analyses of HuC and HuD with the VEGF and c-myc 3'-untranslated regions using a novel ELISA-based assay.
10348344 1999 HuD, a neuronal-specific RNA-binding protein, is a putative regulator of N-myc pre-mRNA processing/stability in malignant human neuroblasts.
9065557 1997 Cell surface expression of paraneoplastic encephalomyelitis/sensory neuronopathy-associated Hu antigens in small-cell lung cancers and neuroblastomas.
8222755 1994 Mapping of the gene coding for a paraneoplastic encephalomyelitis antigen (HuD) to human chromosome site 1p34.
8069866 1994 Molecular analysis of the HuD gene encoding a paraneoplastic encephalomyelitis antigen in human lung cancer cell lines.
7898713 1995 Paraneoplastic encephalomyelitis antigens bind to the AU-rich elements of mRNA.
2166930 1990 Analysis of a neuronal antigen (Hu) expression in the developing rat brain detected by autoantibodies from patients with paraneoplastic encephalomyelitis.
1655278 1991 HuD, a paraneoplastic encephalomyelitis antigen, contains RNA-binding domains and is homologous to Elav and Sex-lethal.
1415481 1992 The expression of the Hu (paraneoplastic encephalomyelitis/sensory neuronopathy) antigen in human normal and tumor tissues.