Property Summary

NCBI Gene PubMed Count 21
PubMed Score 130.94
PubTator Score 78.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.824 1.9e-03
active ulcerative colitis -2.580 3.7e-04
adrenocortical carcinoma 1.318 1.8e-02
adult high grade glioma -2.900 3.7e-05
astrocytic glioma -3.100 1.4e-03
Astrocytoma, Pilocytic -1.600 1.0e-05
atypical teratoid / rhabdoid tumor -3.800 5.4e-05
Breast cancer 1.400 3.9e-03
ependymoma -1.400 1.3e-02
glioblastoma -1.100 9.2e-04
group 3 medulloblastoma 1.300 4.3e-02
malignant mesothelioma 4.300 1.4e-09
medulloblastoma, large-cell 1.600 7.2e-03
oligodendroglioma -2.400 8.1e-03
ovarian cancer -2.000 7.6e-19

Synonym

Accession Q12926 D3DRK3 Q13235 Q59G15 Q8NEM4 Q9H1Q8
Symbols HUB
HELN1
HEL-N1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

METQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKL      1 - 70
VRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKE     71 - 140
LEQLFSQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNGQKPPGATEPITVKFANNPSQKT    141 - 210
NQAILSQLYQSPNRRYPGPLAQQAQRFRLDNLLNMAYGVKRFSPMTIDGMTSLAGINIPGHPGTGWCIFV    211 - 280
YNLAPDADESILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVS    281 - 350
FKTNKTHKA                                                                 351 - 359
//

Text Mined References (24)

PMID Year Title