Property Summary

Ligand Count 3
NCBI Gene PubMed Count 341
PubMed Score 585.80
PubTator Score 433.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.100 7.7e-04
astrocytic glioma -2.000 9.5e-03
Astrocytoma, Pilocytic 1.200 4.8e-06
atypical teratoid / rhabdoid tumor 1.900 7.2e-11
Breast cancer 2.300 3.3e-02
breast carcinoma 1.200 1.2e-03
ependymoma 1.600 6.8e-11
glioblastoma 1.600 8.8e-09
group 3 medulloblastoma 1.300 6.8e-04
lung adenocarcinoma 1.215 6.3e-09
lung cancer 1.300 2.0e-03
medulloblastoma, large-cell 1.500 1.9e-05
Multiple myeloma 1.498 4.7e-03
osteosarcoma 1.046 1.6e-03
ovarian cancer 1.600 3.6e-03
primitive neuroectodermal tumor 1.200 1.9e-03
subependymal giant cell astrocytoma 1.206 3.7e-02
Waldenstrons macroglobulinemia 1.127 9.1e-03

Gene RIF (319)

AA Sequence

MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT      1 - 70
AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD     71 - 140
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP    141 - 210
VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN    211 - 280
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK                            281 - 326
//

Text Mined References (355)

PMID Year Title