Property Summary

NCBI Gene PubMed Count 301
PubMed Score 539.08
PubTator Score 433.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.127 9.1e-03
Multiple myeloma 1.498 4.7e-03
astrocytoma 2.600 6.3e-05
glioblastoma -2.500 1.2e-04
osteosarcoma -2.930 3.9e-07
ependymoma -2.100 2.5e-10
group 3 medulloblastoma 1.500 8.7e-05
atypical teratoid / rhabdoid tumor -3.000 9.7e-07
medulloblastoma, large-cell 2.000 1.1e-06
primitive neuroectodermal tumor 1.400 1.1e-04
lung cancer 1.300 2.0e-03
breast carcinoma 1.200 1.2e-03
Breast cancer 2.300 3.3e-02
pediatric high grade glioma -1.900 1.1e-04
pilocytic astrocytoma -1.600 1.2e-05
subependymal giant cell astrocytoma -2.565 1.8e-02
lung adenocarcinoma 1.215 6.3e-09
ovarian cancer 1.600 3.6e-03

Protein-protein Interaction (167)

XPO1   U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   TNFSF13   BCAS2   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   PRKCA   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   NUP214   POLR2I   RBMX   EIF4A3   BUD31   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SET   SRSF2   CSTF1   SRSF11   PRKCD   SRSF1   SRSF4   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   SRSF7   USP39   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM2   LSM5   LSM4   RBM8A  

Gene RIF (278)

PMID Text
27401462 Results indicate that HuR induces 14-3-3zeta translation via interaction with its 3' UTR and that 14-3-3zeta is necessary for stimulation of intestinal epithelial cell migration after wounding.
27215092 Reduction of miR-31 expression enhanced lung cancer proliferation and migration by repressing HuR expression
26898797 MiR-9 directly targets ELAVL1 in ventricular cardiomyocytes.
26884465 HuR blocks miR-675 processing from H19 and prevents H19-induced intestinal barrier barrier dysfunction.
26874904 These results define a novel mechanism by which PKM2 regulates glioma cell growth, and also define a novel set of potential therapeutic targets along the PKM2-HuR-p27 pathway
26866372 Mesenchymal stromal cells inhibit Human antigen R (HuR) trascription, an enhancer of RENmRNA stability by IL10 release
26819413 miR-424 interacts with long non-coding RNA OIP5-AS1 and competes with HuR for binding to OIP5-AS1.
26764246 Cytoplasmic accumulation of ELAVL1 was identified as a predictor of adverse clinical behavior of prostate cancer.
26731986 Down regulation of miR-31 contributed to the malignant progression of papillary thyroid carcinoma cells by targeting HuR
26692264 HuR protein mediates resistance to carboplatin in ovarian cancer cells.
26677051 The silencing of HuR confirmed that the RNA-binding protein is required for regulation of SOX2 mRNA decay in mesenchymal stem cells.
26675757 HuR mediated post-transcriptional upregulation of COX-2 and HO-1 expression after gemcitabine treatment in pancreatic cancer cells. HuR silencing significantly increased the effectiveness of GEM treatment in vitro.
26640230 HUR mRNA levels are associated with poor survival in metastatic metastatic high-grade ovarian serous carcinoma , whereas protein expression has no prognostic value.
26554012 These data suggest that the disrupted interaction of HuR impairs activity-dependent translation of FMRP, which may hinder synaptic plasticity in a clinically significant fashion.
26527679 loss of Scribble-induced HuR translocation mediates the accumulation of Snail via activation of the p38 MAPK pathway.
26512748 HuR binds to the pyrimidine-rich sequence and antagonize its effect in regulating WT1 +/-KTS isoforms.
26498465 High HUR expression is associated with Thyroid cancer.
26491048 CUGBP1 and HuR negate each other's effects in regulating E-cadherin translation by altering the recruitment of E-cadherin mRNA to PBs and play important roles in the regulation of intestinal barrier integrity.
26451954 HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication
26438598 HuR selectively increased C-reactive protein mRNA stability and promoted C-reactive protein translation
26390015 Data indicate a high throughput approach for identification of small molecules targeting Hu antigen R R HuR/RNA interaction.
26386386 By an interplay between miR-519c, HuR and the length of the 3' untranslated region (UTR) of ABCG2.
26339049 host factor HuR migrates from the nucleus to the cytoplasm and gets recruited in the protein complex assembling at the 3' untranslated region of hepatitis C virus RNA. At the 3' UTR, it facilitates circularization of the viral genome.
26325091 colocalization of HuR and the distal part of the VEGFA 3'-untranslated region (UTR) in the cytoplasm. We propose that under hypoxia-like conditions, HuR enhances VEGFA mRNA translation.
26314962 HuR regulates core biological processes, highlighting that HuR inhibition likely thwarts PDA viability through post-transcriptional regulation of diverse signaling pathways; it impairs malignant characteristics of pancreatic ductal adenocarcinoma cells
26304124 lipids mediate post-transcriptional regulation of HAMP through PKC- and HuR-dependent mechanisms
26189797 Unprecedentedly, HuR was also found to bind to miR-21 directly, preventing its interaction with the PDCD4 3'-UTR, thereby preventing the translation repression of PDCD4.
26062599 HuR, an ARE-binding protein that stabilises transcripts, binds the CBP2 3'UTR. Pro-inflammatory mediators reduce the occupancy of HuR on the CPB2 3'-UTR.
26013954 Methyl(R217)HuR and MCM6 are inversely correlated and are prognostic markers in non small cell lung carcinoma
25980610 Biotin-pulldown assay showed that HuR specifically interacts with the 3'-untranslated region (3'-UTR) of the LTalpha mRNA
25841336 Dimerization model of the C-terminal RNA Recognition Motif of HuR.
25841271 HuR levels were found to be highly representative in liver and colon cancer--{REVIEW}
25830480 Results show that miR-16 and HuR co-regulate the cyclin E1 mRNA without influencing each other's binding or expression. miR-16 regulation predominates, blocking upregulation of cyclin E1 by HuR.
25803745 HuR plays a significant role in centrosome amplification and genomic instability
25801788 RNA stabilizing proteins play a role in the pathophysiology of cardiovascular diseases.
25706256 The authors review the findings about the mechanistic role of HuR in the nucleus and in the regulation of long non coding RNAs and discuss the implications of considering HuR as pharmacological target in human diseases such as cancer. [review]
25678597 HuR blocks the translation of Fas mRNA and effectively prevents Fas-mediated apoptosis in HCC.
25678110 Reduced expression or chemical inhibition of HuR severely hampered the type I IFN response in various cell lines and fibroblast-like synoviocytes isolated from joints of rheumatoid arthritis patients.
25592834 Aberrant activation of AMPK in motor neurons disrupts the normal distribution of HuR, which might imbalance RNA metabolism and contribute to amyotrophic lateral sclerosis pathogenesis.
25588078 Data suggest that p38 MAP kinase regulates c-Fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of ELAVL1/HuR (Hu antigen R).
25534855 These results suggest novel and uncharacterized cytoplasmic beta-catenin functions related to HuR-mediated RNA metabolism in cancer cells.
25449213 UFC1 interact with the mRNA stabilizing protein HuR to increase levels of beta-catenin in hepatocellular carcinoma.
25383675 PDGF-C up-regulation was mediated by the human embryonic lethal abnormal vision-like protein HuR, which stabilizes the PDGF-C transcript by binding to two predicted AU-rich elements (AREs) in the 3'-untranslated region (3'-UTR).
25320093 The anticarcinogenic activities of CRABP2 are mediated by both HuR and RAR.
25252849 Enhanced total HuR expression, as well as its cytoplasmic localization, was significantly associated with increased COX-2 expression in lung cancer.
25239623 HuR regulates TDP-43 and FUS/TLS expression and loss of HuR-mediated RNA processing in astrocytes can alter the molecular and cellular landscape to produce a toxic phenotype
25182852 Our results showed that HuR could be a causal factor of ER-alpha regulation in Ishikawa cells and thus may induce the hormone-dependent endometrial carcinoma.
25010987 HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by upregulating the translation of caspase-2.
24954509 HSF1 regulation of beta-catenin in mammary cancer cells through control of HuR/elavL1 expression.
24865968 The overexpression of a HuR mutant that could not be phosphorylated blocked the associated TRA2beta4 interaction.
24826067 Downregulation of the HuR gene results in decreased beta-actin gene expression, which in turn results in decreased motility and proliferation of corneal fibroblasts.
24719890 The induction of RNA-binding protein HuR expression by HBx mediated the HER2 mRNA stabilization.
24687854 CRABP2 controls mRNA stabilization by HuR.
24658545 results suggest that HuR recognizes the ARE-rich region in the IL-3 3'-UTR and plays a role in the IL-3 3'-UTR-mediated post-transcriptional control in T-cells
24618665 5-FU can increase HuR function by enhancing HuR translocation from the nucleus to the cytoplasm.
24566137 HuR increased SIRT1-Exon8 by promoting SIRT1 exon 8 exclusion.
24536047 A novel mechanism that pancreatic ductal adenocarcinoma cells use to protect against DNA damage in which HuR posttranscriptionally regulates the expression and downstream function of WEE1 upon exposure to DNA-damaging agents.
24534848 high degree of HuR expression with diffuse staining pattern in the epithelium may be an effective diagnostic tool that determines the potential of oral verrucous lesions for malignant transformation
24416409 The prolyl isomerase pin1 regulates mRNA levels of genes with short half-lives by targeting specific RNA binding proteins, such as HuR and AUF1.
24398589 pp32r1 binds to HuR to avoid the caspase-mediated decay of HuR in the cytoplasm of cells.
24390237 Analysis of a cyclinD1 mRNA directly implicated HuR in regulating cyclinD1 production: cyclinD1 translation increased in HuR-shuttling cells induced by AngII and declined in cells in which HuR levels were lowered by RNA interference
24362034 HuR undergoes cleavage modification by caspase-3 following IR-induced oral mucositis and subsequently promotes the expression of the pro-apoptotic factor BAX (Bcl-2-associated X protein), as well as cell death.
24260469 Beta-catenin/HuR post-transcriptional machinery governs cancer stem cell features in response to hypoxia.
24210824 Sequestration of HuR by Sindbis virus is associated with destabilization of cellular mRNAs that normally bind HuR and rely on it to regulate their expression.
24106086 This study indicates that HuR is tyrosine-phosphorylated by JAK3, and link this modification to HuR subcytoplasmic localization and to the fate of HuR target mRNAs.
24086407 The role of HuR in AhR stabilization of Cox-2 mRNA was confirmed by knockdown of HuR, which resulted in rapid Cox-2 mRNA degradation.
24036660 cytoplasmic localization of HuR was significantly associated with malignant potential and poor outcome in breast cancer patients undergoing neoadjuvant chemotherapy.
23969235 ELAVs are involved in the regulation of SOD1 gene expression at post-transcriptional level and that these proteins are more activated in ALS pathology
23901138 miR-29 has a role in protecting the tumor suppressor A20 mRNA from degradation by HuR in sarcoma
23894643 regulation of ELAVL1/HuR in HLA-B27-expressing U937 monocytic cells
23889148 HuR cytoplasmic expression correlates with adverse prognosticators and cyclin A overexpression, and also independently predicts worse survival, indicating a causative role in conferring tumour aggressiveness in gastrointestinal stromal tumours
23873103 high cytoplasmic HuR expression is associated with positive lymph node metastasis, deep tumor invasion, high stage, and poor survival in ESCC.
23852810 Cytoplasmic expression of HuR is associated with cIAP2 expression in OSCCs
23837869 CARM1 represses replicative senescence by methylating HuR.
23814050 resveratrol induces HuR, SIRT1, and MAT2B expression; the last may represent a compensatory response against apoptosis and growth inhibition.
23813879 ATR stabilizes the CDKN1A message in response to UV damage through Cdk1-related cytoplasmic accumulation of HuR.
23722602 HuR expression correlates with different adverse phenotypes of gallbladder carcinoma.
23605320 cytoplasmic HuR expression detected by immunohistochemical staining is a negative prognostic indicator for survival in patients with breast cancer
23572284 PTHrP mRNA is stabilized by HuR in human lung adenocarcinoma cells
23528537 HuR antigen regulates HOXA5 gene expression via modulating HOXA5 mRNA turnover and translation, respectively, thereby contributing to RA-induced growth inhibition.
23519412 The X-ray structure of two methylated tandem RRM domains (RRM1/2) of Hu antigen R (HuR) in their RNA-free form has been solved.
23516604 Cytoplasmic HuR appears to play important roles in cell proliferation, progression, and survival of bladder cancer. Its expression was associated with angiogenesis, lymphangiogenesis, and expressions of VEGF-A and -C.
23430747 Human antigen R-mediated mRNA stabilization is required for ultraviolet B-induced autoinduction of amphiregulin in keratinocytes.
23401122 The TTP:HuR mRNA ratios were also perturbed in samples from invasive breast cancer patients when compared with normal tissues, and were associated with invasion gene expression.
23394580 Suggest a model for the combined regulatory activity of miR-200c and HuR on TUBB3 expression in ovarian cancer and on prognosis.
23376935 A translational network composed of RNA Recognition Motif-type RNA binding proteins mRNAs are positively controlled by HuR.
23269677 analysis of post-transcriptional regulation of meprin alpha by the RNA-binding proteins Hu antigen R (HuR) and tristetraprolin (TTP)
23223443 analysis of an antagonistic function of the RNA-binding protein HuR and miR-200b in post-transcriptional regulation of vascular endothelial growth factor-A expression and angiogenesis
23176121 Data indicate that nitric oxide downregulates decay accelerating factor (DAF) expression by inhibiting its promoter activity possibly through a decreased binding of Sp1 in association of HuR.
23155001 HuR promotes occludin translation by blocking occludin mRNA translocation to P-bodies via the displacement of CUGBP1.
23127556 It was shown that posttranscriptional control of Egr-1 expression requires the RNA-binding protein HuR. It was also shown that the Egr-1 3' UTR mediates posttranscriptional regulation of Egr-1 by HuR.
23125841 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23115237 mutational analysis indicates that IKKalpha-dependent phosphorylation at Ser-304 is crucial to the binding of HuR to beta-TrCP1.
23052832 HuR's involvement in critical cellular processes depend on its recognition of secondary structure motifs together with primary sequence in target RNAs.
23028944 Data suggest that HuR maintains cell proliferation and polarity of mammary epithelial cells at least in part via DeltaNp63.
22983828 Heat-induced changes of HuR and of hnRNP A1, causes the proteins to exit the nucleus and co-localize to large cytoplasmic foci that represent heat-induced stress granules.
22921787 these results provide evidence that the cancer cell growth suppression by this 62nt RNA containing AU-rich elements may be due to competitive binding to HuR.
22915590 virus-induced HuR relocalization to the cytoplasm is specific to alphavirus infections and is associated with distinct posttranslational modifications of this RNA-binding protein.
22907529 ELAVL1 gene polymorphisms may have some contributing role in determining survival outcome of breast cancer patients
22906436 Data show that exposure of hepatocytes to direct hypoxia resulted in acid sphingomyelinase activation and ceramide elevation associated with activation of caspase 5 and the subsequent cleavage of HuR and apoptotic cell death.
22829587 Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function
22674407 This study demonstrates a central role for HuR in Akt signaling and reveals a mechanism by which modest changes in HuR levels below or above normal may be amplified, potentially resulting in cell death or cellular transformation.
22576182 Here, we have demonstrated that HuR silencing has pleiotropic and beneficial functions during cholestactic liver injury and HSC activation.
22562506 -actin is downregulated in the corneal stroma of patients with KC, which may be related to reduced levels of a stabilizing factor (HuR) for beta-actin mRNA.
22445740 Female transgenic mice expressing HuR in astrocytes have significantly less clinical disability and histopathological changes in the spinal cord.
22436134 Restoration of HuR expression in these cells resensitized MCF-7/doxoR cells to doxorubicin, reactivating the apoptotic response.
22426177 It was demonstrated for the first time that HuR post-transcriptionally regulates IL-6 expression mainly via tristetraprolin in human pulmonary microvascular endothelial cells. Tristetraprolin had no effect on HuR expression and subcellular localization.
22371495 a novel mechanism by which HuR is regulated by RNPC1 via mRNA stability and HuR is a mediator of RNPC1-induced growth suppression.
22368252 The HuR binding site within the 3'-UTR of MTA1 is a classical AU rich element-type sequence.
22362742 The results show that HuR translocation to cytoplasm is enhanced by insulin leading to AT1R upregulation through HuR-mediated stabilization of AT1R mRNA.
22310293 MiR-9 directly targets HuR and Dicer1 for posttranscriptional repression.
22258704 Musashi1 is regulated by HuR via mRNA translation and stability in glioblastoma cells.
22212710 AMPK activation could effectively decrease PDGF-induced HuR cytoplasmatic translocation.
22095636 Mdm2/NEDD8/HuR regulatory framework is essential for the malignant transformation of tumor cells
22086907 AUF1 and HuR bind to VEGFA ARE RNA under both normoxic and hypoxic conditions, and a pVHL-RNP complex determines VEGFA mRNA decay.
22086295 HuR promotes wound healing, primarily through its effect on cellular adhesion.
22049153 HuR inhibits microRNA-16 targeting of COX-2.
21994574 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21971048 HuR and miR-331-3p participate in the overexpression of ERBB-2 observed in some PCas.
21935886 Evidence that links HuR to several specific cancers and its potential usefulness in cancer diagnosis, prognosis, and therapy.
21890634 HuR sites in 3'-UTRs overlap extensively with predicted microRNA target sites, suggesting interplay between the functions of HuR and microRNAs.
21862584 Mutation of HuR Thr-118 reduced the association between HuR and cPLA(2)alpha mRNA under IL-1beta treatment
21859890 HUR was found to interact with the nucleolin (NCL) 3'UTR and specifically promoted nucleolin translation without affecting nucleolin mRNA levels.
21858080 Data show that hnRNPA1/A2, HuR and DAZAP1 splicing factors and DHX36 RNA helicase bind to the ISE, with hnRNPA1 acting negatively and DAZAP1 positively on splicing selection
21795698 an important role for HuR in hypoxia, and we may have revealed a novel post-transcriptional mechanism that controls c-Myc expression in oral cancer progression.
21768308 HuR enhances TOP2A translation by competing with miR-548c-3p; their combined actions control TOP2A expression levels and determine the effectiveness of doxorubicin.
21723171 The human RBP HuR/ELAVL1 is a conserved mRNA stability regulator.
21723170 HuR couples pre-mRNA processing with mature mRNA stability.
21646354 a role for the nuclear trafficking factor TRN2 (transportin 2) through HuR in cell death.
21627034 HuR is able to disengage miRNAs from the repressed mRNA [review]
21613615 HuR-driven posttranscriptional control plays a significant role in T cell development and effector function in both human and transgenic systems.
21596928 Vascular protease-activated receptor (PAR)-3, unlike PAR-1, is regulated post-transcriptionally via the mRNA-stabilizing factor HuR.
21572400 Cytoplasmic HuR expression is associated with COX-2 expression in lung squamous cell carcinomas.
21543858 recombinant AU-rich element-binding region of HuR (residues 18-186) was crystallized in space group P2(1)2(1)2, with unit-cell parameters a = 41.2, b = 133.1, c = 31.4 A. X-ray diffraction data were collected
21503589 human antigen R knockdown reduces the growth and invasion of breast cancer cells in vitro and affects expression of cyclin D1 and MMP-9
21498545 The RNA-binding protein HuR promotes glioma growth and treatment resistance
21443519 The RNA-binding protein HuR stabilizes survivin mRNA in human oesophageal epithelial cells
21343335 this thus demonstrates that C/EBPbeta is indeed regulated at the posttranscriptional level by HuR in ALK(+) anaplastic large cell lymphomas.
21317874 The authors propose that the release of HuR-bound mRNAs via an ionizing radiation-Chk2-HuR regulatory axis improves cell outcome following ionizing radiation.
21310943 High-constitutive HuR phosphorylation at Ser 318 by PKC{delta} propagates tumor relevant functions in colon carcinoma.
21273615 Reduced Human antigen R is associated with breast cancer metastasis.
21220697 Association of HuR with four endogenous chemokine mRNAs in airway epithelium is validated by single-gene ribonucleoprotein-immunoprecipitation and shown to be 3' untranslated region (UTR)-dependent by biotin pull-down assay.
21206905 LFA-1-induced stabilization of ARE-containing mRNAs in T cells is dependent on HuR, and occurs through the Vav-1, Rac1/2, MKK3 and p38MAPK signaling cascade
21161467 The HuR protein regulates the expression of COX-2 in renal cell carcinoma (RCC) cells, which is one potential mechanism of action for the HuR-associated aggressive behaviour of RCC.
21152064 Data provide evidence that the tumor suppressor function of pp32 can be attributed to its ability to disrupt HuR binding to target mRNAs encoding key proteins for cancer cell survival and drug efficacy.
21102524 XIAP belongs to the HuR-regulated RNA operon of antiapoptotic genes, which, along with Bcl-2, Mcl-1 and ProTalpha, contributes to the regulation of cell survival.
21046284 Cytoplasmic expression of HuR was identified as an independent prognostic factor for survival in non-small lung cell carcinoma.
20960565 the cytoplasmic expression of HuR is associated with COX-2 expression in oral squamous cell carcinoma and HuR can regulate COX-2 expression in oral cancer cell lines.
20951677 These results suggest that the TIA and HuR cellular ratio influences cell-type specific Fas exon 6 splicing pattern.
20889954 Increased HuR levels in the mid-menstrual phases are likely to contribute to reduced mid-cycle cytokine expression and enhanced cellular survival in eutopic endometrium
20739277 beta(2)-AR mRNA is recognized by the nucleocytoplasmic shuttling RNA-binding protein HuR, which silences translational initiation while chaperoning the mRNA-protein complex to the cell periphery
20724828 HuR overexpression significantly interfered with tumor growth in orthotopic mouse models.
20692039 demonstrating that HuR reduced the stability of decay accelerating factor (DAF) mRNA and suggesting that it is of importance in regulating the expression of DAF
20675370 FasL mRNA forms a complex with the RNA-binding protein HuR both in vitro and ex vivo.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626035 important role of miR-16 in regulating HuR translation and the link of this regulatory pathway to human breast cancer.
20587520 HuR gene silencing revealed that TUBB3 translation is HuR dependent in hypoglycemia because HuR silencing inhibited the entry of TUBB3 mRNA into cytoskeletal and free polysomes.
20459669 These results suggest that HuR does not impact HIV-1 replication through a direct protein-protein interaction with the viral reverse transcriptase.
20459669 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20421296 Data show MAT2beta variants reside mostly in the nucleus and regulate HuR subcellular content to affect cell proliferation.
20370918 This is a side-by-side genome-wide comparison of HuR-associated targets in wild type ER+ and ER- breast cancer. Differential regulation of two cancer-related genes by HuR was contingent upon the cellular environment.
20353946 response to lethal stress, PKR, without being phosphorylated, activates the FADD/caspase-8/caspase-3 pathway to trigger HuR cleavage, and the HuR-CPs are then capable of promoting apoptosis
20351266 HuR plays a critical role in inducing inflammatory response of endothelial cells under mechanical and biochemical stresses
20332213 These findings suggest that HuR knockdown changes the features of oral cancer cells, at least in part, by affecting their cell cycle and shows potential as an effective therapeutic approach.
20305372 Data reveal that miR-519 inhibits tumorigenesis in large part by repressing HuR expression.
20219773 that expression of VEGF, TNF-beta and of the HIF-2alpha as well as constitutive activation of the oncogenic phosphoinositide 3-kinase/Akt, nuclear factor-kappaB and mitogen-activated protein kinase pathways were decreased in HuR-depleted cells and tumors
20219472 in vitro, HuR RRM1 and RRM1,2 homodimerization involves a disulfide bond at cysteine 13. This homodimerization mode may have a functional significance in redox modulation of HuR activity in response to oxidative stress.
20102719 Immunofluorescent analysis revealed increased levels of HuR and AUF1, and a decrease in methyl-HuR levels in human livers with hepatocellular carcinoma.
20086103 Simultaneous phosphorylation at different domains by PKCdelta coordinates mRNA binding and nucleocytoplasmic shuttling of HuR.
20018854 Analysis of HuR upstream regions revealed sequences necessary for regulation of the shorter mRNA. Within the long, G+C-rich 5'-UTR exist multiple copies of the alternate Smad 1/5/8-binding motif GCCGnCGC.
19931428 interactions between hnRNP and HuR proteins that were identified in the context of isolated hnRNP and mRNP complexes
19917608 Data suggest that stress kinases (such as p38(MAPK)) as well as HuR are excellent targets for approaches aiming at interfering with induction of COX-2 expression by UVB.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875930 miR-125a may function as a tumor suppressor for breast cancer, with HuR as a direct and functional target.
19805546 SOD1 sequesters Hu antigen R (HuR) and TIA-1-related protein (TIAR) and has a role in impaired post-transcriptional regulation of vascular endothelial growth factor
19750561 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19728080 HuR binds to the GATA3 3'UTR. Inhibition of HuR decreased GATA3 mRNA, mRNA stability & protein expression.
19671677 HuR seems to play a positive role in both regulation of bcl-2 mRNA translation and mRNA stability.
19648294 Demonstration of SMN protein regulation through the p38 pathway and the role of HuR in this modulation may help in the identification and characterization of p38 pathway activators as potential therapeutic compounds for the treatment of SMA.
19647848 HIV-1 IRES activity is suppressed by HuR while HCV IRES activity is enhanced.
19574298 RNA-binding protein HuR reduced c-Myc expression by associating with the c-Myc 3' untranslated region (UTR) next to a miRNA let-7-binding site
19528229 Data show that inhibition of p38 MAPK and its phosphorylation of HuR impairs p21(Cip1) accumulation and, as a result, the ability of cells to arrest in G(1) in response to gamma radiation.
19520857 HuR knockdown reduced the expression of endogenous bcl-2, whereas unexpectedly, a bcl-2 ARE{(AU)-rich elements} -reporter transcript increased significantly, suggesting that HuR expression has opposite effects on endogenous and ectopic bcl-2 ARE.
19420963 HuR expression in non-small cell lung cancer correlates with vascular endothelial growth factor-C expression and lymph node metastasis
19322201 Heat shock transiently lowers HuR by proteolysis linked to K182 ubiquitination and that HuR reduction enhances cell survival following heat shock
19289500 Data show that nitric oxide (NO) stabilizes mRNA subsets in fibroblasts, that HuR alone is insufficient for stabilizing several mRNAs by NO, and show that heme oxygenase-1 induction by NO is regulated by HuR.
19281587 HuR (Hu antigen R)expression in the nucleus correlates with high histological grade and poor disease-free survival in ovarian cancer.
19255485 An RNA-binding region of human HuR containing two N-terminal RNA-recognition motif domains bound to an 11-base RNA fragment has been crystallized.
19252527 RNase L downmodulation of the RNA-binding protein, HuR, and cellular growth.
19221430 This study found that the content of nELAV proteins is significantly decreased along with clinical dementia progression in the hippocampi of AD brains, where it inversely correlates with the amount of amyloid-beta (Abeta).
19151756 findings suggest that HuR plays a supportive role for c-fms in breast cancer progression by binding a 69-nt element in its 3'UTR, thus regulating its expression
19114552 identified a distinct AU-rich element in the 3'UTR of eIF4E which is responsible for HuR-mediated binding and stabilization
19109971 These findings suggest that HuR actively contributes to RNA modification and maturation and thereby shed an entirely new light on the role of HuR in RNA metabolism.
19106619 CUG-BP1 and HuR act as factors that bind to the SBP2 3' UTR, which suggests that TTR-RBPs play a role in the regulation of SBP2
19088191 the growth-promoting effects of antisense miR-519 required the presence of HuR
19056930 PTHrP expression studies confirmed the involvement of HuR in PTHrP upregulation in this disease.
19010922 Posttranscriptional regulation of the breast cancer susceptibility gene BRCA1 by the RNA binding protein HuR.
19009247 High expression of HuR is associated with colorectal adenocarcinoma.
18991684 In the present report we show that the RNA-binding protein ELAV/HuR can affect, post-transcriptionally, the fate of HSP70 mRNA following H(2)O(2)-mediated oxidative stress in SH-SY5Y human neuroblastoma cells.
18986664 In differentiated cervical epithelial cells HuR may bind and stabilise L1 mRNAs aiding translation of L1 protein.
18831511 HuR plays a role in tumor progression in mesothelioma and that COX-2 may be a target of its activity
18824170 HuR is a direct transcription target of NF-kappaB; its activation in gastric cancer cell lines depends on phosphatidylinositol 3-kinase/AKT signaling. HuR activation by this pathway has proliferative and antiapoptotic effects on gastric cancer cells.
18769129 Cytoplasmic accumulation of HUR is central to tamoxifen resistance in estrogen receptor positive breast cancer cells.
18705402 COX-2 expression in Ewing sarcoma may not be directly related to mRNA stabilization by HuR. However, a correlation between COX-2 expression and nuclear HuR expression through indirect mRNA stabilization can be suggested.
18650551 UV cross-linking and immunoprecipitation experiments revealed 2 ARE-binding proteins, AUF1 and HuR, associated with IL-8 mRNA in saliva.
18648668 overexpression of HuR as found in many progressive tumors could be causative for disarranged Eph receptor to ephrin ligand ratios leading to a higher degree of tissue invasiveness
18644987 The mRNA stability factor HuR was shown to support ERBB2 transcript integrity, bind and endogenously associate with a conserved U-rich element within the ERBB2 transcript 3' UTR, and colocalize with HDAC6.
18641687 global changes in HuR-bound mRNAs are implicated in the evolution to a more tumorigenic phenotype in an in vivo tumor model.
18593881 Cdk1 phosphorylates HuR during G2, thereby helping to retain it in the nucleus in association with 14-3-3 and hindering its post-transcriptional function and anti-apoptotic influence.
18579691 HuR plays an important role in suppression of TM protein synthesis in IL-1beta treatment and sepsis
18544151 These results suggest that HuR may be involved in and may modulate the reverse transcription reaction of HIV-1, by an as yet unknown mechanism involving a protein-protein interaction with HIV-1 reverse transcriptase.
18544151 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18505733 absence of two critical adenosine/uridine-rich elements in the alternatively spliced CD3zeta 3'-UTR found in systemic lupus erythematosus T cells may result in decreased HuR binding
18498284 These findings suggest that the expression of VEGF-A and cytoplasmic translocation of HuR relates to the histological grade, and that HuR is involved in the upregulation of VEGF-A expression, in human astrocytic tumors.
18490444 MKP-1 upregulation by oxidative stress is potently influenced by increased mRNA stability and translation, mediated at least in part by the RNA-binding proteins HuR and NF90.
18463097 a functional link between HuR as repressor of alternative Fas splicing and the molecular mechanisms modulating programmed cell death.
18449856 UVB irradiatiion regulates COX2 mRNA stability through AMPK and HuR in human keratinocytes.
18408768 Multiple pathways are involved in the anoxia response of SKIP3 including HuR-regulated RNA stability, NF-kappaB and ATF4
18317686 HuR is involved in the upregulation of VEGF-A expression in human meningiomas.
18285462 Posttranslational modification of HuR by protein kinase Cdelta represents an important novel mode of HuR activation implied in renal COX-2 regulation
18279945 Mitogen-induced interleukin (IL)-13 expression involves changes in mRNA transcript turnover and a change in phosphorylation of Hu antigen R (HuR) and its association with the mRNA 3'-untranslated regions.
18202756 the subcellular localization of HuR is deregulated in a subset of prostate carcinomas, and that this deregulation is linked to an altered expression of the tumorigenic COX-2 protein as well as to an adverse patient prognosis
18180367 HuR association with pp32/PHAP-I and its caspase-mediated cleavage constitutes a regulatory step that contributes to an amplified apoptotic response.
18095988 Primary Merkel cell carcinomas and their lymph node metastases as well as non-neoplastic skin show nuclear expression of HuR protein.
18094611 The role of cytoplasmic expression of HuR is as a biomarker for progression of adenomas in familial polposis coli.
18051367 Tandem affinity purification and mass spectrometry analysis identify ELAV-like 1 protein (ELAVL1; Hu antigen R, HUR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
18027256 There was a statistically significant correlation between COX-2 immunoreactivity and the cytoplasmic HuR expression level in laryngeal squamous cell carcinoma.
17967866 HuR and PTB jointly upregulate HIF-1alpha translation in response to CoCl(2)
17878526 both HuR and AUF1 bind to discrete regions of DENR/DRP mRNA and that AUF1 silencing increases DENR/DRP protein levels.
17626845 Two mRNA binding proteins, HuR and AUF1, are colocalized and are capable of functional interaction in both the nucleus and cytoplasm.
17599736 Positive correlations between Hu antigen R gene expression in patients with rheumatoid and healthy persons.
17581403 Cytoplasmic HuR expression is significantly associated with tumor size, stage, and lymphatic/vascular invasion in uterine cervical carcinoma and is correlated with cyclooxygenase 2 expression.
17548472 These data establish that the posttranscriptional event involving HuR-mediated beta-actin mRNA stabilization could be a part of the regulatory mechanisms responsible for maintaining cell integrity.
17534146 Review. HuR binds to & promotes the expression of mRNAs for Bcl-2 & Mcl-1. HuR is a key upstream coordinator of a constitutive pro-survival program.
17531241 Down regulation of HuR expression by siRNA prevents atazanavir-induced increase of TNF-alpha and IL-6, suggesting that HuR might have an impact on pathophysiological processes of HIV PI-induced atherosclerosis
17517897 analysis of distinct roles for the HuR hinge and RRM3 domains in formation of cooperative HuR.ARE complexes in solution
17392515 Data show that regulation of HuR via protein kinase C alpha-dependent phosphorylation emphasizes the importance of posttranslational modification for stimulus-dependent HuR shuttling.
17317627 HuR regulates SIRT1 expression, underscore functional links between the two stress-response proteins, and implicate Chk2 in these processes.
17237228 HuR-dependent regulation of RNase-L enhances its antiviral activity, demonstrating the functional significance of this regulation
17178712 the signal sequences in APRIL that mediate its intracellular trafficking and provide evidence that this protein ligand of HuR is an important player in the post-transcriptional regulation of CD83 expression
17132932 The RNA-binding protein HuR regulates the stability and translation of target mRNAs, while no HuR mutations have been found in cancer, a link between HuR and malignant transformation has been suggested in cancers of the breast, colon, lung and ovary.
16990552 Activation of NADPH oxidase and MAPK-signaling pathway contribute to HuR-mediated stabilization of TLR4 mRNA induced by LPS in human aortic smooth muscle cells (HASMCs). Stimulation of HASMCs with LPS increased the cytosolic HuR level in vitro.
16935932 IL-10 sensitivity to TNF depends on the ability of IL-10 to inhibit the expression and mRNA-stabilizing protein HuR and via IL-10 mediated repression of p38 mitogen-activated protein (MAP) kinase activation
16912169 HuR critically contributes to cyclin E1 overexpression and its growth-promoting function in breast cancer cells.
16890199 adenosine/uridine (AU)-rich element-binding protein HuR (Hu antigen R) interacts with the beta-F1-ATPase mRNA through an AU-rich sequence located to the 3'-UTR.
16820934 Results describe the gene expression of tristetraprolin, T-cell intracellular antigen and Hu antigen R in synovial tissues from rheumatoid arthritis and osteoarthritis patients.
16788138 role for HuR in protecting kidney epithelia from injury during ischemic stress
16581801 HUR maintains cytochrome c biosynthesis.
16494882 The mRNAs for GM-CSF and TNF-alpha - established ARE-containing targets for HuR-mediated regulation - were upregulated by LPL-mediated lipolysis in ECAP.
16484227 the HuR-CRM1 axis affects the nucleocytoplasmic translocation of CD83 mRNA under regular physiological conditions
16455966 HuR-mediated mRNA stabilization, stimulated by integrin engagement and controlled at the level of HuR nuclear export, is critically involved in T cell activation
16289864 c-Yes 3'-UTR contains at least three newly identified adenine/uridine-rich elements (AREs) which are bound specifically by ARE-binding proteins HuR and AUF1.
16135804 HuR is a key mediator of posttranscriptional regulation and expression of the SLC11A1 gene.
16109718 coordinated regulation of mRNA stability by HuR and AUF1 proteins contributes to the observed increase in ATF3 expression following amino acid limitation
15914670 The function of HuR as a 5'-UTR-binding protein and dual-purpose translation repressor may be critical for the precise regulation of type I insulin-like growth factor receptor expression.
15824116 HuR contributes to regulating human vascular smooth muscle cell growth and homeostasis in pathologies associated with vascular smooth muscle proliferation
15514971 IL-8 RNA from IL-1beta-stimulated cytoplasmic extract revealed a 20-fold greater association of transcript with the stabilizing factor HuR in breast csancer cells.
15371446 PGA2 stabilizes the p21 mRNA through an ERK-independent increase in cytoplasmic HuR levels and an ERK-dependent association of HuR with the p21 mRNA
15342649 Results point to importin alpha1 as a critical downstream target of AMP-activated protein kinase (AMPK) and key mediator of AMPK-triggered HuR nuclear import.
15328200 Overexpression of HuR in tumor tissue may be part of a regulatory pathway that controls the mRNA in breast cancer
15257295 composition and fate (stability, translation) of HuR- and/or AUF1-containing ribonucleoprotein complexes depend on the target mRNA of interest, RNA-binding protein abundance, stress condition, and subcellular compartment
14981256 an HuR target RNA motif and a general strategy for identifying target motifs for RNA-binding proteins
14981248 Transportin-2 mediates nuclear import of HuR protein in vitro
14715706 AUF1 p40, HuR, and the 3'UTR of the CTR mRNA transcript could be involved in posttranscriptional regulation of CTR mRNA expression.
14562043 HuR-regulated target mRNA expression contributes to colon cancer growth.
14530362 Overexpression of HuR in bronchial epithelial cells significantly increases the expression and stability of eotaxin mRNA and protein.
14517288 HuR and MK2 have roles in regulating the expression of uPA and uPAR genes at the posttranscriptional level
14517280 HuR has a role in enhancing VHL-mediated p53 translation
12933794 HADHB, HuR, and CP1 are novel REN mRNA-binding proteins that target a cis-element in the 3'-UTR of REN mRNA and regulate renin production
12821781 The 3' UTR of p53 was found to be a target of the RNA-binding protein HuR in a UVC-dependent manner in vitro and in vivo. HuR plays a role in binding to the p53 mRNA and enhancing its translation
12730239 AMP-activated protein kinase activation can cause premature fibroblast senescence through mechanisms that likely involve reduced HuR function.
12431987 p21(WAF1) protein expression is mediated by stabilization of p21(WAF1) mRNA elicited via multiple 3'-UTR cis-elements. HuR binds at least one of these elements, does not appear to be a modulator of p21(WAF1) expression or growth inhibition in this system
12242302 Highly selective actions of HuR in antagonizing AU-rich element-mediated mRNA destabilization.
12237300 Data show that the RNA-binding protein HuR is specifically methylated on Arg(217) by coactivator-associated arginine methyltransferase 1 (CARM1).
12011088 The binding of HuR, CP1, and CP2 to AR mRNA suggests a role for each of these proteins in the post-transcriptional regulation of AR expression in cancer cells.
11971974 Results show that AMP-activated kinase (AMPK), an enzyme involved in responding to metabolic stresses, potently regulates the levels of cytoplasmic HuR.
11834731 A 40-bp RNA element that mediates stabilization of vascular endothelial growth factor mRNA by HuR. (HuR RNA binding protein)
11729309 role in c-fos mRNA export

AA Sequence

MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT      1 - 70
AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD     71 - 140
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP    141 - 210
VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN    211 - 280
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK                            281 - 326
//

Text Mined References (314)

PMID Year Title
27401462 2016 Posttranscriptional regulation of 14-3-3? by RNA-binding protein HuR modulating intestinal epithelial restitution after wounding.
27215092 2016 MiR-31 Functions as a Tumor Suppressor in Lung Adenocarcinoma Mainly by Targeting HuR.
27089893 2016 Post-transcriptional regulation of Wnt co-receptor LRP6 and RNA-binding protein HuR by miR-29b in intestinal epithelial cells.
26898797 2016 MicroRNA-9 inhibits hyperglycemia-induced pyroptosis in human ventricular cardiomyocytes by targeting ELAVL1.
26884465 2016 H19 Long Noncoding RNA Regulates Intestinal Epithelial Barrier Function via MicroRNA 675 by Interacting with RNA-Binding Protein HuR.
26874904 2016 PKM2 uses control of HuR localization to regulate p27 and cell cycle progression in human glioblastoma cells.
26866372 2016 Mesenchymal Stromal Cells Prevent Renal Fibrosis in a Rat Model of Unilateral Ureteral Obstruction by Suppressing the Renin-Angiotensin System via HuR.
26819413 2016 LncRNA OIP5-AS1/cyrano sponges RNA-binding protein HuR.
26764246 2016 Cytoplasmic accumulation of ELAVL1 is an independent predictor of biochemical recurrence associated with genomic instability in prostate cancer.
26731986 2015 miR-31 Reduces Cell Growth of Papillary Thyroid Carcinoma by RNA-Binding Protein HuR.
26692264 2015 Chemogenomic Study of Carboplatin in Saccharomyces cerevisiae: Inhibition of the NEDDylation Process Overcomes Cellular Resistance Mediated by HuR and Cullin Proteins.
26677051 2016 Human Antigen R Binding and Regulation of SOX2 mRNA in Human Mesenchymal Stem Cells.
26675757 2015 HuR mediated post-transcriptional regulation as a new potential adjuvant therapeutic target in chemotherapy for pancreatic cancer.
26640230 2016 HUR mRNA expression in ovarian high-grade serous carcinoma effusions is associated with poor survival.
26554012 2015 A 3' untranslated region variant in FMR1 eliminates neuronal activity-dependent translation of FMRP by disrupting binding of the RNA-binding protein HuR.
26527679 2016 Loss of Scribble Promotes Snail Translation through Translocation of HuR and Enhances Cancer Drug Resistance.
26512748 2015 HuR antagonizes the effect of an intronic pyrimidine-rich sequence in regulating WT1 +/-KTS isoforms.
26498465 2016 Clinical Significance of Hu-Antigen Receptor (HuR) and Cyclooxygenase-2 (COX-2) Expression in Human Malignant and Benign Thyroid Lesions.
26491048 2016 CUGBP1 and HuR regulate E-cadherin translation by altering recruitment of E-cadherin mRNA to processing bodies and modulate epithelial barrier function.
26451954 2015 HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication.
26438598 2015 Posttranscriptional Regulation of the Inflammatory Marker C-Reactive Protein by the RNA-Binding Protein HuR and MicroRNA 637.
26390015 2015 Identification of Small-Molecule Inhibitors of the HuR/RNA Interaction Using a Fluorescence Polarization Screening Assay Followed by NMR Validation.
26386386 2015 Exploiting a novel miR-519c-HuR-ABCG2 regulatory pathway to overcome chemoresistance in colorectal cancer.
26339049 2015 HuR Displaces Polypyrimidine Tract Binding Protein To Facilitate La Binding to the 3' Untranslated Region and Enhances Hepatitis C Virus Replication.
26325091 2015 Induction of VEGFA mRNA translation by CoCl2 mediated by HuR.
26314962 2015 Targeting the mRNA-binding protein HuR impairs malignant characteristics of pancreatic ductal adenocarcinoma cells.
26304124 2015 Saturated fatty acids induce post-transcriptional regulation of HAMP mRNA via AU-rich element-binding protein, human antigen R (HuR).
26189797 2016 RNA-binding protein HuR sequesters microRNA-21 to prevent translation repression of proinflammatory tumor suppressor gene programmed cell death 4.
26062599 2015 Pro-inflammatory cytokines reduce human TAFI expression via tristetraprolin-mediated mRNA destabilisation and decreased binding of HuR.
26013954 2015 Methyl(R217)HuR and MCM6 are inversely correlated and are prognostic markers in non small cell lung carcinoma.
25980610 2015 Lymphotoxin ?, a novel target of posttranscriptional gene regulation by HuR in HepG2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25841336 2015 Dimerization model of the C-terminal RNA Recognition Motif of HuR.
25841271 2015 NEDDylation in liver cancer: The regulation of the RNA binding protein Hu antigen R.
25830480 2015 MicroRNA-16 modulates HuR regulation of cyclin E1 in breast cancer cells.
25803745 2015 Growth factor dependent regulation of centrosome function and genomic instability by HuR.
25801788 2015 RNA-stabilizing proteins as molecular targets in cardiovascular pathologies.
25706256 2015 Targeting the multifaceted HuR protein, benefits and caveats.
25678597 2015 HuR Suppresses Fas Expression and Correlates with Patient Outcome in Liver Cancer.
25678110 2015 The RNA-binding protein HuR/ELAVL1 regulates IFN-? mRNA abundance and the type I IFN response.
25592834 2015 Aberrant activation of AMP-activated protein kinase contributes to the abnormal distribution of HuR in amyotrophic lateral sclerosis.
25588078 2015 An interplay between the p38 MAPK pathway and AUBPs regulates c-fos mRNA stability during mitogenic stimulation.
25534855 2015 HuR represses Wnt/?-catenin-mediated transcriptional activity by promoting cytoplasmic localization of ?-catenin.
25449213 2015 The long intergenic noncoding RNA UFC1, a target of MicroRNA 34a, interacts with the mRNA stabilizing protein HuR to increase levels of ?-catenin in HCC cells.
25416956 2014 A proteome-scale map of the human interactome network.
25383675 2014 Post-transcriptional up-regulation of PDGF-C by HuR in advanced and stressed breast cancer.
25320093 2014 Cellular retinoic acid-binding protein 2 inhibits tumor growth by two distinct mechanisms.
25252849 2015 Hu-antigen receptor (HuR) and cyclooxygenase-2 (COX-2) expression in human non-small-cell lung carcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
25239623 2014 Hu antigen R (HuR) is a positive regulator of the RNA-binding proteins TDP-43 and FUS/TLS: implications for amyotrophic lateral sclerosis.
25182852 2014 Expression of the ELAV-like protein HuR in the cytoplasm is associated with endometrial carcinoma progression.
25010987 2014 Attenuation of the ELAV1-like protein HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by increasing the translation of caspase-2L.
24954509 2015 HSF1 regulation of ?-catenin in mammary cancer cells through control of HuR/elavL1 expression.
24865968 2014 HuR regulates alternative splicing of the TRA2? gene in human colon cancer cells under oxidative stress.
24826067 2014 Downregulation of ?-actin and its regulatory gene HuR affect cell migration of human corneal fibroblasts.
24719890 2014 Hepatitis B virus X upregulates HuR protein level to stabilize HER2 expression in hepatocellular carcinoma cells.
24687854 2014 Transcript stabilization by the RNA-binding protein HuR is regulated by cellular retinoic acid-binding protein 2.
24658545 2014 The role of HuR in the post-transcriptional regulation of interleukin-3 in T cells.
24618665 2014 dCK expression correlates with 5-fluorouracil efficacy and HuR cytoplasmic expression in pancreatic cancer: a dual-institutional follow-up with the RTOG 9704 trial.
24566137 2014 HuR and TIA1/TIAL1 are involved in regulation of alternative splicing of SIRT1 pre-mRNA.
24536047 2014 HuR posttranscriptionally regulates WEE1: implications for the DNA damage response in pancreatic cancer cells.
24534848 2014 Cytoplasmic expression of HuR may be a valuable diagnostic tool for determining the potential for malignant transformation of oral verrucous borderline lesions.
24416409 2014 The prolyl isomerase pin1 regulates mRNA levels of genes with short half-lives by targeting specific RNA binding proteins.
24398589 2014 pp32r1 controls the decay of the RNA-binding protein HuR.
24390237 2014 AngiotensinII induces HuR shuttling by post-transcriptional regulated CyclinD1 in human mesangial cells.
24362034 2014 Inhibition of caspases protects mice from radiation-induced oral mucositis and abolishes the cleavage of RNA-binding protein HuR.
24260469 2013 Beta-catenin/HuR post-transcriptional machinery governs cancer stem cell features in response to hypoxia.
24210824 2013 Changes in cellular mRNA stability, splicing, and polyadenylation through HuR protein sequestration by a cytoplasmic RNA virus.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24106086 2014 Tyrosine phosphorylation of HuR by JAK3 triggers dissociation and degradation of HuR target mRNAs.
24086407 2013 Aryl hydrocarbon receptor-dependent retention of nuclear HuR suppresses cigarette smoke-induced cyclooxygenase-2 expression independent of DNA-binding.
24036660 2013 Predictive and prognostic significance of cytoplasmic expression of ELAV-like protein HuR in invasive breast cancer treated with neoadjuvant chemotherapy.
23969235 2013 Posttranscriptional regulation of SOD1 gene expression under oxidative stress: Potential role of ELAV proteins in sporadic ALS.
23901138 2013 miR-29 acts as a decoy in sarcomas to protect the tumor suppressor A20 mRNA from degradation by HuR.
23894643 2013 Altered regulation of ELAVL1/HuR in HLA-B27-expressing U937 monocytic cells.
23889148 2013 HuR cytoplasmic expression is associated with increased cyclin A expression and inferior disease-free survival in patients with gastrointestinal stromal tumours (GISTs).
23873103 2014 Cytoplasmic expression of the ELAV-like protein HuR as a potential prognostic marker in esophageal squamous cell carcinoma.
23852810 2014 Cytoplasmic HuR expression: correlation with cellular inhibitors of apoptosis protein-2 expression and clinicopathologic factors in oral squamous cell carcinoma cells.
23837869 2013 Loss of CARM1 is linked to reduced HuR function in replicative senescence.
23814050 2013 Methionine adenosyltransferase 2B, HuR, and sirtuin 1 protein cross-talk impacts on the effect of resveratrol on apoptosis and growth in liver cancer cells.
23813879 2014 ATR controls the UV-related upregulation of the CDKN1A mRNA in a Cdk1/HuR-dependent manner.
23722602 2013 Clinicopathological significance of HuR expression in gallbladder carcinoma: with special emphasis on the implications of its nuclear and cytoplasmic expression.
23640942 2013 Subcellular localization and RNP formation of IGF2BPs (IGF2 mRNA-binding proteins) is modulated by distinct RNA-binding domains.
23605320 2013 Cytoplasmic HuR expression correlates with P-gp, HER-2 positivity, and poor outcome in breast cancer.
23572284 2013 Hu/elav RNA-binding protein HuR regulates parathyroid hormone related peptide expression in human lung adenocarcinoma cells.
23528537 2013 Retinoic acid-induced HOXA5 expression is co-regulated by HuR and miR-130a.
23519412 2013 The structure of the ARE-binding domains of Hu antigen R (HuR) undergoes conformational changes during RNA binding.
23516604 2013 High expression of HuR in cytoplasm, but not nuclei, is associated with malignant aggressiveness and prognosis in bladder cancer.
23430747 2013 Human antigen R-mediated mRNA stabilization is required for ultraviolet B-induced autoinduction of amphiregulin in keratinocytes.
23401122 2013 miR-29a inhibition normalizes HuR over-expression and aberrant AU-rich mRNA stability in invasive cancer.
23394580 2013 MiR-200c and HuR in ovarian cancer.
23376935 2013 Hyper conserved elements in vertebrate mRNA 3'-UTRs reveal a translational network of RNA-binding proteins controlled by HuR.
23269677 2013 Post-transcriptional regulation of meprin ? by the RNA-binding proteins Hu antigen R (HuR) and tristetraprolin (TTP).
23223443 2013 Antagonistic function of the RNA-binding protein HuR and miR-200b in post-transcriptional regulation of vascular endothelial growth factor-A expression and angiogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23176121 2013 Role of transcription factor Sp1 and RNA binding protein HuR in the downregulation of Dr+ Escherichia coli receptor protein decay accelerating factor (DAF or CD55) by nitric oxide.
23155001 2013 Competitive binding of CUGBP1 and HuR to occludin mRNA controls its translation and modulates epithelial barrier function.
23127556 2012 HuR posttranscriptionally regulates early growth response-1 (Egr-1) expression at the early stage of T cell activation.
23115237 2012 The mRNA-stabilizing factor HuR protein is targeted by ?-TrCP protein for degradation in response to glycolysis inhibition.
23056314 2012 Angiogenesis inhibitor vasohibin-1 enhances stress resistance of endothelial cells via induction of SOD2 and SIRT1.
23052832 2012 Insights from the HuR-interacting transcriptome: ncRNAs, ubiquitin pathways, and patterns of secondary structure dependent RNA interactions.
23028944 2012 HuR is necessary for mammary epithelial cell proliferation and polarity at least in part via ?Np63.
22983828 2013 HuR-hnRNP interactions and the effect of cellular stress.
22921787 2012 Cancer cell growth suppression by a 62nt AU-rich RNA from C/EBP? 3'UTR through competitive binding with HuR.
22915590 2012 Dephosphorylation of HuR protein during alphavirus infection is associated with HuR relocalization to the cytoplasm.
22907529 2013 Genetic polymorphisms in RNA binding proteins contribute to breast cancer survival.
22906436 2012 The role of acid sphingomyelinase and caspase 5 in hypoxia-induced HuR cleavage and subsequent apoptosis in hepatocytes.
22829587 2012 Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22674407 2013 HuR inhibits apoptosis by amplifying Akt signaling through a positive feedback loop.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22576182 2012 Human antigen R contributes to hepatic stellate cell activation and liver fibrosis.
22562506 2012 Downregulation of ?-actin gene and human antigen R in human keratoconus.
22445740 2012 Sex hormone-dependent attenuation of EAE in a transgenic mouse with astrocytic expression of the RNA regulator HuR.
22436134 2012 Downregulation of HuR as a new mechanism of doxorubicin resistance in breast cancer cells.
22426177 2012 HuR post-transcriptionally regulates TNF-?-induced IL-6 expression in human pulmonary microvascular endothelial cells mainly via tristetraprolin.
22371495 2012 The RNA-binding protein RNPC1 stabilizes the mRNA encoding the RNA-binding protein HuR and cooperates with HuR to suppress cell proliferation.
22368252 2012 Sequence requirements for RNA binding by HuR and AUF1.
22362742 2012 Regulation of AT1R expression through HuR by insulin.
22310293 2012 Inhibition of miR-9 de-represses HuR and DICER1 and impairs Hodgkin lymphoma tumour outgrowth in vivo.
22258704 2012 The oncogenic RNA-binding protein Musashi1 is regulated by HuR via mRNA translation and stability in glioblastoma cells.
22212710 2012 PDGF-induced airway smooth muscle proliferation is associated with Human antigen R activation and could be weakened by AMPK activation.
22095636 2012 Murine double minute 2 regulates Hu antigen R stability in human liver and colon cancer through NEDDylation.
22086907 2012 Association of the von Hippel-Lindau protein with AUF1 and posttranscriptional regulation of VEGFA mRNA.
22086295 2012 Role of HuR in keratinocyte migration and wound healing.
22049153 2012 The mRNA stability factor HuR inhibits microRNA-16 targeting of COX-2.
21971048 2011 The RNA-binding protein HuR opposes the repression of ERBB-2 gene expression by microRNA miR-331-3p in prostate cancer cells.
21935886 Posttranscriptional regulation of cancer traits by HuR.
21890634 2011 Genomic analyses of the RNA-binding protein Hu antigen R (HuR) identify a complex network of target genes and novel characteristics of its binding sites.
21862584 2011 The RNA-binding protein HuR stabilizes cytosolic phospholipase A2? mRNA under interleukin-1? treatment in non-small cell lung cancer A549 Cells.
21859890 2011 Competitive regulation of nucleolin expression by HuR and miR-494.
21858080 2011 Interaction of hnRNPA1/A2 and DAZAP1 with an Alu-derived intronic splicing enhancer regulates ATM aberrant splicing.
21795698 2011 Caspase-mediated cleavage of RNA-binding protein HuR regulates c-Myc protein expression after hypoxic stress.
21768308 2011 Translational control of TOP2A influences doxorubicin efficacy.
21723171 2011 Transcriptome-wide analysis of regulatory interactions of the RNA-binding protein HuR.
21723170 2011 Integrative regulatory mapping indicates that the RNA-binding protein HuR couples pre-mRNA processing and mRNA stability.
21646354 2011 Transportin 2 regulates apoptosis through the RNA-binding protein HuR.
21627034 2010 Properties of the regulatory RNA-binding protein HuR and its role in controlling miRNA repression.
21613615 2011 Coordinate regulation of GATA-3 and Th2 cytokine gene expression by the RNA-binding protein HuR.
21596928 2011 Regulation of human vascular protease-activated receptor-3 through mRNA stabilization and the transcription factor nuclear factor of activated T cells (NFAT).
21572400 2011 Expression of HuR, COX-2, and survivin in lung cancers; cytoplasmic HuR stabilizes cyclooxygenase-2 in squamous cell carcinomas.
21543858 2011 Preliminary crystallographic analysis of the RNA-binding domain of HuR and its poly(U)-binding properties.
21503589 2011 Knockdown of human antigen R reduces the growth and invasion of breast cancer cells in vitro and affects expression of cyclin D1 and MMP-9.
21498545 2011 The RNA-binding protein HuR promotes glioma growth and treatment resistance.
21443519 2011 The RNA-binding protein HuR stabilizes survivin mRNA in human oesophageal epithelial cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21343335 2011 HuR-mediated control of C/EBPbeta mRNA stability and translation in ALK-positive anaplastic large cell lymphomas.
21317874 2011 Global dissociation of HuR-mRNA complexes promotes cell survival after ionizing radiation.
21310943 2011 High-constitutive HuR phosphorylation at Ser 318 by PKC{delta} propagates tumor relevant functions in colon carcinoma cells.
21273615 2011 Prognostic value of the human antigen R (HuR) in human breast cancer: high level predicts a favourable prognosis.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21220697 2011 Chemokine transcripts as targets of the RNA-binding protein HuR in human airway epithelium.
21206905 2010 T cell LFA-1 engagement induces HuR-dependent cytokine mRNA stabilization through a Vav-1, Rac1/2, p38MAPK and MKK3 signaling cascade.
21161467 2011 HuR expression is a marker of poor prognosis in renal cell carcinoma.
21152064 2010 pp32 (ANP32A) expression inhibits pancreatic cancer cell growth and induces gemcitabine resistance by disrupting HuR binding to mRNAs.
21102524 2011 RNA-binding protein HuR mediates cytoprotection through stimulation of XIAP translation.
21046284 2011 Cytoplasmic HuR expression correlates with angiogenesis, lymphangiogenesis, and poor outcome in lung cancer.
20960565 2011 Association between expression of embryonic lethal abnormal vision-like protein HuR and cyclooxygenase-2 in oral squamous cell carcinoma.
20951677 2010 Cell-specific regulation of Fas exon 6 splicing mediated by Hu antigen R.
20889954 2011 The mRNA-binding protein HuR is regulated in the menstrual cycle and repressed in ectopic endometrium.
20739277 2010 Novel mechanisms in the regulation of G protein-coupled receptor trafficking to the plasma membrane.
20724828 2010 Overexpression of the RNA binding protein HuR impairs tumor growth in triple negative breast cancer associated with deficient angiogenesis.
20692039 2010 Binding of human antigen R (HuR) to an AU-rich element (ARE) in the 3'untranslated region (3'UTR) reduces the expression of decay accelerating factor (DAF).
20675370 2010 FasL expression in activated T lymphocytes involves HuR-mediated stabilization.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626035 2010 Loss of repression of HuR translation by miR-16 may be responsible for the elevation of HuR in human breast carcinoma.
20587520 2010 HuR regulates beta-tubulin isotype expression in ovarian cancer.
20459669 2010 The RNA binding protein HuR does not interact directly with HIV-1 reverse transcriptase and does not affect reverse transcription in vitro.
20421296 2010 Novel function and intracellular localization of methionine adenosyltransferase 2beta splicing variants.
20370918 2010 The RNA binding protein HuR differentially regulates unique subsets of mRNAs in estrogen receptor negative and estrogen receptor positive breast cancer.
20353946 2010 Protein kinase RNA/FADD/caspase-8 pathway mediates the proapoptotic activity of the RNA-binding protein human antigen R (HuR).
20351266 2010 HuR regulates the expression of stress-sensitive genes and mediates inflammatory response in human umbilical vein endothelial cells.
20332213 2010 HuR knockdown changes the oncogenic potential of oral cancer cells.
20305372 2010 miR-519 suppresses tumor growth by reducing HuR levels.
20219773 2010 Role of the RNA-binding protein HuR in human renal cell carcinoma.
20219472 2010 The x-ray crystal structure of the first RNA recognition motif and site-directed mutagenesis suggest a possible HuR redox sensing mechanism.
20102719 2010 HuR/methyl-HuR and AUF1 regulate the MAT expressed during liver proliferation, differentiation, and carcinogenesis.
20086103 2010 Tandem phosphorylation of serines 221 and 318 by protein kinase Cdelta coordinates mRNA binding and nucleocytoplasmic shuttling of HuR.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20018854 2010 Transcriptional control of human antigen R by bone morphogenetic protein.
19946888 2010 Defining the membrane proteome of NK cells.
19931428 2010 Extensive association of HuR with hnRNP proteins within immunoselected hnRNP and mRNP complexes.
19917608 2010 Role of HuR and p38MAPK in ultraviolet B-induced post-transcriptional regulation of COX-2 expression in the human keratinocyte cell line HaCaT.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875930 MicroRNA-125a represses cell growth by targeting HuR in breast cancer.
19805546 2009 Amyotrophic lateral sclerosis-linked mutant SOD1 sequesters Hu antigen R (HuR) and TIA-1-related protein (TIAR): implications for impaired post-transcriptional regulation of vascular endothelial growth factor.
19728080 2010 The RNA-binding protein HuR regulates GATA3 mRNA stability in human breast cancer cell lines.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19671677 2009 Regulation of Bcl-2 expression by HuR in HL60 leukemia cells and A431 carcinoma cells.
19648294 2009 p38 Mitogen-activated protein kinase stabilizes SMN mRNA through RNA binding protein HuR.
19647848 2009 The Elav-like protein HuR exerts translational control of viral internal ribosome entry sites.
19574298 2009 HuR recruits let-7/RISC to repress c-Myc expression.
19561594 2009 Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins.
19528229 2009 p38 Mitogen-activated protein kinase- and HuR-dependent stabilization of p21(Cip1) mRNA mediates the G(1)/S checkpoint.
19520857 2009 B cell lymphoma (Bcl)-2 protein is the major determinant in bcl-2 adenine-uridine-rich element turnover overcoming HuR activity.
19420963 2009 The expression of RNA-binding protein HuR in non-small cell lung cancer correlates with vascular endothelial growth factor-C expression and lymph node metastasis.
19322201 2009 Ubiquitin-mediated proteolysis of HuR by heat shock.
19289500 2009 Analysis of nitric oxide-stabilized mRNAs in human fibroblasts reveals HuR-dependent heme oxygenase 1 upregulation.
19281587 2009 HuR expression in the nucleus correlates with high histological grade and poor disease-free survival in ovarian cancer.
19255485 2009 Cloning, expression, purification and preliminary crystallographic studies of the adenylate/uridylate-rich element-binding protein HuR complexed with its target RNA.
19252527 2009 RNase L downmodulation of the RNA-binding protein, HuR, and cellular growth.
19221430 2009 nELAV proteins alteration in Alzheimer's disease brain: a novel putative target for amyloid-beta reverberating on AbetaPP processing.
19151756 2009 Regulation of non-AU-rich element containing c-fms proto-oncogene expression by HuR in breast cancer.
19114552 2009 Stability of eukaryotic translation initiation factor 4E mRNA is regulated by HuR, and this activity is dysregulated in cancer.
19109971 2009 Terminal adenosyl transferase activity of posttranscriptional regulator HuR revealed by confocal on-bead screening.
19106619 Known turnover and translation regulatory RNA-binding proteins interact with the 3' UTR of SECIS-binding protein 2.
19088191 2008 miR-519 reduces cell proliferation by lowering RNA-binding protein HuR levels.
19056930 2009 von Hippel-Lindau tumor suppressor gene-dependent mRNA stabilization of the survival factor parathyroid hormone-related protein in human renal cell carcinoma by the RNA-binding protein HuR.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
19010922 2008 Posttranscriptional regulation of the breast cancer susceptibility gene BRCA1 by the RNA binding protein HuR.
19009247 2009 Tissue microarray analysis of 560 patients with colorectal adenocarcinoma: high expression of HuR predicts poor survival.
18991684 2008 Post-transcriptional regulation of HSP70 expression following oxidative stress in SH-SY5Y cells: the potential involvement of the RNA-binding protein HuR.
18986664 2009 The RNA stability regulator HuR regulates L1 protein expression in vivo in differentiating cervical epithelial cells.
18831511 2008 Expression of the embryonic lethal abnormal vision-like protein HuR in human mesothelioma: association with cyclooxygenase-2 and prognosis.
18824170 2008 NF-kappaB activates transcription of the RNA-binding factor HuR, via PI3K-AKT signaling, to promote gastric tumorigenesis.
18769129 2008 Cytoplasmic accumulation of the RNA binding protein HuR is central to tamoxifen resistance in estrogen receptor positive breast cancer cells.
18705402 Expression of embryonic lethal abnormal vision (ELAV)-like protein HuR and cyclooxygenase-2 (COX-2) in Ewing sarcoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18650551 2008 AUF1 and HuR proteins stabilize interleukin-8 mRNA in human saliva.
18648668 2008 Comparative 3'UTR analysis allows identification of regulatory clusters that drive Eph/ephrin expression in cancer cell lines.
18644987 2008 Destabilization of ERBB2 transcripts by targeting 3' untranslated region messenger RNA associated HuR and histone deacetylase-6.
18641687 2008 Post-transcriptional gene regulation by HuR promotes a more tumorigenic phenotype.
18593881 2008 Nuclear HuR accumulation through phosphorylation by Cdk1.
18579691 2008 RNA-binding protein HuR interacts with thrombomodulin 5'untranslated region and represses internal ribosome entry site-mediated translation under IL-1 beta treatment.
18544151 2008 HuR interacts with human immunodeficiency virus type 1 reverse transcriptase, and modulates reverse transcription in infected cells.
18505733 2008 The RNA-stabilizing protein HuR regulates the expression of zeta chain of the human T cell receptor-associated CD3 complex.
18498284 2008 Expression of vascular endothelial growth factor-A and mRNA stability factor HuR in human astrocytic tumors.
18490444 2008 MKP-1 mRNA stabilization and translational control by RNA-binding proteins HuR and NF90.
18463097 2008 Hu antigen R (HuR) functions as an alternative pre-mRNA splicing regulator of Fas apoptosis-promoting receptor on exon definition.
18449856 2008 UVB irradiation regulates Cox-2 mRNA stability through AMPK and HuR in human keratinocytes.
18408768 2008 Multiple pathways are involved in the anoxia response of SKIP3 including HuR-regulated RNA stability, NF-kappaB and ATF4.
18317686 2008 Expression of vascular endothelial growth factor-A and mRNA stability factor HuR in human meningiomas.
18285462 2008 Posttranslational modification of the AU-rich element binding protein HuR by protein kinase Cdelta elicits angiotensin II-induced stabilization and nuclear export of cyclooxygenase 2 mRNA.
18279945 2008 Posttranscriptional regulation of IL-13 in T cells: role of the RNA-binding protein HuR.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18202756 2008 Expression of the ELAV-like protein HuR in human prostate carcinoma is an indicator of disease relapse and linked to COX-2 expression.
18180367 2008 Caspase-mediated cleavage of HuR in the cytoplasm contributes to pp32/PHAP-I regulation of apoptosis.
18161049 2008 Natural antisense transcript stabilizes inducible nitric oxide synthase messenger RNA in rat hepatocytes.
18095988 2008 Expression of HuR in Merkel cell carcinoma and in normal skin.
18094611 2008 Increased expression of cytoplasmic HuR in familial adenomatous polyposis.
18027256 2007 Cytoplasmic HuR over-expression is associated with increased cyclooxygenase-2 expression in laryngeal squamous cell carcinomas.
17967866 2008 RNA-binding proteins HuR and PTB promote the translation of hypoxia-inducible factor 1alpha.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17878526 Post-transcriptional control of the MCT-1-associated protein DENR/DRP by RNA-binding protein AUF1.
17632515 2007 Identification and mechanistic characterization of low-molecular-weight inhibitors for HuR.
17626845 2007 FRET-detectable interactions between the ARE binding proteins, HuR and p37AUF1.
17599736 2007 Effects of infliximab therapy on gene expression levels of tumor necrosis factor alpha, tristetraprolin, T cell intracellular antigen 1, and Hu antigen R in patients with rheumatoid arthritis.
17581403 2007 Expression of HuR is associated with increased cyclooxygenase-2 expression in uterine cervical carcinoma.
17548472 2007 The RNA-binding protein HuR promotes cell migration and cell invasion by stabilizing the beta-actin mRNA in a U-rich-element-dependent manner.
17534146 2007 Posttranscriptional orchestration of an anti-apoptotic program by HuR.
17531241 2007 HIV protease inhibitors increase TNF-alpha and IL-6 expression in macrophages: involvement of the RNA-binding protein HuR.
17517897 2007 Specific protein domains mediate cooperative assembly of HuR oligomers on AU-rich mRNA-destabilizing sequences.
17392515 2007 Protein kinase C alpha-dependent phosphorylation of the mRNA-stabilizing factor HuR: implications for posttranscriptional regulation of cyclooxygenase-2.
17317627 2007 Phosphorylation of HuR by Chk2 regulates SIRT1 expression.
17237228 2007 Post-transcriptional regulation of RNase-L expression is mediated by the 3'-untranslated region of its mRNA.
17178712 2007 Analysis of nucleocytoplasmic trafficking of the HuR ligand APRIL and its influence on CD83 expression.
17132932 2005 HuR: post-transcriptional paths to malignancy.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16990552 2006 The role of human antigen R, an RNA-binding protein, in mediating the stabilization of toll-like receptor 4 mRNA induced by endotoxin: a novel mechanism involved in vascular inflammation.
16935932 2006 IL-10-induced TNF-alpha mRNA destabilization is mediated via IL-10 suppression of p38 MAP kinase activation and inhibition of HuR expression.
16912169 2006 HuR contributes to cyclin E1 deregulation in MCF-7 breast cancer cells.
16890199 2006 Control of the ATP synthase beta subunit expression by RNA-binding proteins TIA-1, TIAR, and HuR.
16820934 2006 Expression of TNF-alpha, tristetraprolin, T-cell intracellular antigen-1 and Hu antigen R genes in synovium of patients with rheumatoid arthritis.
16788138 2006 Expression and distribution of HuR during ATP depletion and recovery in proximal tubule cells.
16581801 2006 Translational control of cytochrome c by RNA-binding proteins TIA-1 and HuR.
16494882 2006 LPL-mediated lipolysis of VLDL induces an upregulation of AU-rich mRNAs and an activation of HuR in endothelial cells.
16484227 2006 Expression of CD83 is regulated by HuR via a novel cis-active coding region RNA element.
16455966 2006 LFA-1-dependent HuR nuclear export and cytokine mRNA stabilization in T cell activation.
16289864 2005 The c-Yes 3'-UTR contains adenine/uridine-rich elements that bind AUF1 and HuR involved in mRNA decay in breast cancer cells.
16135804 2005 RNA-binding protein HuR is required for stabilization of SLC11A1 mRNA and SLC11A1 protein expression.
16126846 2005 Involvement of KSRP in the post-transcriptional regulation of human iNOS expression-complex interplay of KSRP with TTP and HuR.
16109718 2005 Interaction of RNA-binding proteins HuR and AUF1 with the human ATF3 mRNA 3'-untranslated region regulates its amino acid limitation-induced stabilization.
15914670 2005 The ELAV RNA-stability factor HuR binds the 5'-untranslated region of the human IGF-IR transcript and differentially represses cap-dependent and IRES-mediated translation.
15824116 2005 Enhanced proliferation of cultured human vascular smooth muscle cells linked to increased function of RNA-binding protein HuR.
15635413 2005 Nucleolar proteome dynamics.
15514971 2005 IL-1beta induces stabilization of IL-8 mRNA in malignant breast cancer cells via the 3' untranslated region: Involvement of divergent RNA-binding factors HuR, KSRP and TIAR.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371446 2004 Prostaglandin A2-mediated stabilization of p21 mRNA through an ERK-dependent pathway requiring the RNA-binding protein HuR.
15342649 2004 AMP-activated protein kinase-regulated phosphorylation and acetylation of importin alpha1: involvement in the nuclear import of RNA-binding protein HuR.
15328200 2004 Expression of the ELAV-like protein HuR is associated with higher tumor grade and increased cyclooxygenase-2 expression in human breast carcinoma.
15257295 2004 Concurrent versus individual binding of HuR and AUF1 to common labile target mRNAs.
15231747 2004 A protein interaction framework for human mRNA degradation.
15175342 2004 Poly(A)-binding protein-interacting protein 2, a strong regulator of vascular endothelial growth factor mRNA.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15037768 2004 Transportins 1 and 2 are redundant nuclear import factors for hnRNP A1 and HuR.
14981256 2004 Identification of a target RNA motif for RNA-binding protein HuR.
14981248 2004 Transportin2 functions as importin and mediates nuclear import of HuR.
14715706 2004 Interaction between 3' untranslated region of calcitonin receptor messenger ribonucleic acid (RNA) and adenylate/uridylate (AU)-rich element binding proteins (AU-rich RNA-binding factor 1 and Hu antigen R).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562043 2003 Role of the RNA-binding protein HuR in colon carcinogenesis.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
14530362 2003 Regulation of eotaxin gene expression by TNF-alpha and IL-4 through mRNA stabilization: involvement of the RNA-binding protein HuR.
14517288 2003 Stabilization of urokinase and urokinase receptor mRNAs by HuR is linked to its cytoplasmic accumulation induced by activated mitogen-activated protein kinase-activated protein kinase 2.
14517280 2003 Influence of the RNA-binding protein HuR in pVHL-regulated p53 expression in renal carcinoma cells.
12933794 2003 HADHB, HuR, and CP1 bind to the distal 3'-untranslated region of human renin mRNA and differentially modulate renin expression.
12855701 2003 The proximal region of the 3'-untranslated region of cyclooxygenase-2 is recognized by a multimeric protein complex containing HuR, TIA-1, TIAR, and the heterogeneous nuclear ribonucleoprotein U.
12821781 2003 RNA-binding protein HuR enhances p53 translation in response to ultraviolet light irradiation.
12730239 2003 Increased AMP:ATP ratio and AMP-activated protein kinase activity during cellular senescence linked to reduced HuR function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12431987 2003 The 3'-untranslated region of p21WAF1 mRNA is a composite cis-acting sequence bound by RNA-binding proteins from breast cancer cells, including HuR and poly(C)-binding protein.
12242302 2002 Highly selective actions of HuR in antagonizing AU-rich element-mediated mRNA destabilization.
12237300 2002 Lipopolysaccharide-induced methylation of HuR, an mRNA-stabilizing protein, by CARM1. Coactivator-associated arginine methyltransferase.
12011088 2002 Novel binding of HuR and poly(C)-binding protein to a conserved UC-rich motif within the 3'-untranslated region of the androgen receptor messenger RNA.
11834731 2002 A 40-bp RNA element that mediates stabilization of vascular endothelial growth factor mRNA by HuR.
11729309 2001 Delineation of mRNA export pathways by the use of cell-permeable peptides.
11018049 2000 Protein ligands to HuR modulate its interaction with target mRNAs in vivo.
10848602 2000 HuD RNA recognition motifs play distinct roles in the formation of a stable complex with AU-rich RNA.
10660597 2000 Purification and characterization of beta-adrenergic receptor mRNA-binding proteins.
10629032 2000 HuR regulates p21 mRNA stabilization by UV light.
10079173 1999 Analysis of the RNA recognition motifs of human neuronal ELAV-like proteins in binding to a cytokine mRNA.
9003489 1997 Localization of the human HuR gene to chromosome 19p13.2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8626503 1996 Cloning and characterization of HuR, a ubiquitously expressed Elav-like protein.