Property Summary

NCBI Gene PubMed Count 237
PubMed Score 3831.97
PubTator Score 850.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 3.003 4.5e-02
osteosarcoma -8.182 3.5e-13
Atopic dermatitis -1.700 3.6e-04
acute myeloid leukemia -1.700 3.0e-02
psoriasis -1.100 1.5e-08

Protein-protein Interaction (2)

Gene RIF (178)

PMID Text
26567890 Different ELANE mutants show specific activation of different UPR pathways in congenital neutropenia.
26444279 An increased NE: A1 AT ratio is closely associated with liver Inflammation in patients with NASH and could serve as a novel marker to predict NASH in humans
26372354 insights into the PPE and HNE inhibition
26269588 analysis of the mechanistic link between neutrophil elastase expression in atherosclerotic plaques and concomitant pro-inflammatory bioactive IL-1beta secretion from endothelial cells
26221769 Neutrophil elastase activity is deleterious for airway epithelial cell homeostasis.
26193632 Pathogenesis of ELANE-mutant severe neutropenia revealed by induced pluripotent stem cells.
26174650 Paternal Somatic Mosaicism of a Novel Frameshift Mutation in ELANE Causing Severe Congenital Neutropenia.
26018813 Neutrophil elastase was increased in the saliva from COPD patients and additionally distinguished smoking status.
25956321 results suggest that elastase-like proteases in the microglial cells surrounding Abeta plaques are responsible for ApoE degradation in the brain.
25912133 mosaic mutations result in cyclic neutropenia
25893670 In patients with carotid plaques, both circulating and intraplaque polymorphonuclear neutrophils produce IL-8, VEGF and elastase, which are crucial for plaque development and progression.
25878251 PAR2 and TRPV4 are activated by neutrophil elastase to cause inflammation and pain
25857284 Autoprocessing of neutrophil elastase near its active site reduces the efficiency of natural and synthetic elastase inhibitors.
25666548 Sirtinol is a novel HNE inhibitor and may have the potential for clinical application in the treatment of inflammatory lung diseases.
25652853 Over-expressed NE in K562 leukemia cells promotes cell proliferation, inhibits apoptosis and block cell cycle in S phase.
25465717 Neutrophil elastase mainly enhances tissue factor production by monocytes via the phospholipase C/conventional PKC/p38 MAPK pathway, although a novel PKC is also involved.
25427142 Sequencing is useful for predicting outcomes of ELANE-associated neutropenia.
25284053 Three proteins-matrix metalloproteinase-9, neutrophil elastase, and FAM49B-were significantly lower in abundance in samples from women with endometriosis.
25248056 expression levels of ELANE and CTSG were determined by quantitative real-time PCR
25195861 The imbalance between Neutrophil elastase and its inhibitors, such as elafin, presents an important therapeutic target in breast cancer.
25092677 Circulating protein levels and enzymatic activity of ELANE are markedly elevated in patients with type 1 diabetes mellitus, and are correlated with increased autoantibodies against beta-cell antigens.
24929239 These in vivo data provide, for the first time, compelling evidence of the collateral involvement of cathepsin G, NE, and proteinase 3 in cigarette smoke-induced tissue damage and emphysema
24914212 An interactive network of elastase, secretases, and PAR-2 protein regulates CXCR1 receptor surface expression on neutrophils
24877096 Elastase and cathepsin G are elevated in the plasma of HD patients, originating from primed PMNLs. In these patients, chronic elevation of these enzymes contributes to cleavage of VE-cadherin and possible disruption of endothelial integrity.
24848868 Human sex hormone-binding globulin mediates the targeted release of cortisol at sites of inflammation through cleavage of its reactive center loop by neutrophil elastase.
24816969 Suggest a potential role of ELANE gene polymorphisms as therapy modulators in childhood bronchiectasis.
24616599 The leukocyte elastase gene is substituted at the 597th base (G to A) in intron 4 of severe congenital neutropenia.
24513040 The present findings highlight the peculiar activity of PMN elastase in disabling EMILIN1 suppressor function.
24184683 ELANE mutations disrupt translation initiation and are associated with neutropenia; they produce novel neutrophil elastase isoforms
24052258 Neutrophil elastase and proteinase-3 trigger G protein-biased signaling through proteinase-activated receptor-1 (PAR1).
24023624 Polymorphonuclear cell proteases, especially neutrophil elastase, degrade decorin, and this degradation renders collagen fibrils more susceptible to MMP-1 cleavage.
23911525 It reports the synthesis and enzymatic studies on a new proteinase 3 intermolecular quenched substrate with enhanced selectivity over neutrophil elastase.
23819644 neutrophil elastase reflects the severity and progression of acute pancreatitis.
23741370 SPLUNC1 degradation by neutrophil elastase may increase airway susceptibility to bacterial infections.
23692169 Neutrophil elastase activity in BAL fluid in early life was associated with early bronchiectasis in children with cystic fibrosis.
23564510 Human neutrophil elastase induced goblet cell metaplasia in the wild-type mice and that HNE-induced goblet cell metaplasia was significantly attenuated in the Tace conditional deletion mice.
23463630 Specific ELANE mutations have limited predictive value for leukemogenesis; the risk for leukemia was correlated with disease severity rather than with occurrence of an ELANE mutation.
23454784 4 ELANE mutations, 11 HAX1 mutations and 2 G6PC3 mutations have been identified in Iranian patients with severe congenital neutropenia.
23392769 Neutrophil elastase can increase PAR2 expression and MUC5AC release.
23351986 A review discusses how ELANE mutations provide clues into the pathogenesis of cyclic and severe congenital neutropenia.
23001948 E-cadherin expression correlated negatively with PMN infiltration, compatible with the notion that E-cadherin is cleaved by PMN-derived elastase
22996420 Overexpression of G185R ELA2 mutant increases apoptosis through an unfolded protein response.
22993338 Variations in SERPINA1 and ELA2 were not consistently or strongly associated with the risk of either COPD or NSCLC in either African Americans or caucasian.
22918834 Neutrophil extracellular traps-associated elastase digested amyloid fibrils into short species that were cytotoxic for BHK-21 and HepG2 cells.
22915586 NE and CG bind to the surface of cancer cells, presumably to a cell surface receptor, and subsequently undergo clathrin pit-mediated endocytosis.
22683569 High elastase expression is associated with defective alveolar septation and arrested lung growth.
22500123 Report on development of pulmonary emphysema after intratracheal instillation of human neutrophil elastase.
22407864 Chamomile infusion inhibited expression of neutrophil elastase and matrix metalloprotease-9 in adenocarcinoma gastric cells.
22174830 In a process reminiscent of neutrophil extracellular traps formation, NE enhances sputum solubilization.
21843618 Tagetes erecta flower showed effective inhibition of leukocyte elastase.
21796505 ELANE genetic polymorphism is associated with development of periodontitis in patients with severe congenital neutropenia
21731773 heparin is able to accelerate the hydrolysis of TIMP-1 by HNE.
21605276 Plasma neutrophil elastase may be involved in the pathogenesis of severe pneumonia.
21576245 a new mode of PAR regulation that involves biased PAR(2) signaling by neutrophil elastase and a disarming/silencing effect of cathepsin-G and proteinase-3.
21488974 potential of HNE and CatG to be used as markers for early detection of infection. Significant differences in HNE and CatG levels in infected and non-infected wound fluids were observed.
21477798 Immature dendritic cells treated with neutrophilic elastase or polymorphonuclear culture supernatant, promote the generation of CD4+FOXP3+ Tregs in vitro.
21475777 catalyses inactivation of factor VIII(a)via limited proteolysis
21448199 SCN with the identification of a mutation in the ELANE gene.
21425445 Four novel heterozygous mutations in the ELANE gene in patients with congenital neutropenia
21236472 The study shows that the alternative pathway for plasmin-mediated fibrinolysis by leukocyte elastase is activated, and contributes to the degradation of cross-linked fibrin in sepsis-induced disseminated intravascular coagulation.
21206270 The majority of patients with severe congenital neutropenia bear monoallelic mutations in the neutrophil elastase (ELANE) gene
21193404 NE is the predominant protease that cleaves hemoglobin in vivo in cystic fibrosis bronchoalveolar lavage fluid
20974816 The neutrophil elastase (NE) escapes from azurophilic granules and translocates to the nucleus, where it partially degrades specific histones, promoting chromatin decondensation.
20932306 Human neutrophil elastase treatment does not modify short-circuit current in control or nasal epithelial cells from cystic fibrosis patients.
20883273 NE significantly promotes the proliferation of HaCaT cell. Meanwhile, it also up-regulates the expression levels of Ki67 and p53 in psoriasis lesion tissue, which plays an important role in the pathogenesis of psoriasis lesion.
20828556 The trafficking of precursor NE (proNE) and precursor PR3 (proPR3), was compared.
20803142 Results describe a multigenerational family with mutations in ELANE as unambiguous cause of severe congenital neutropenia.
20646231 Findings of significantly elevated serum MMP-9, myeloperoxidase, and neutrophil elastase together with decreased TIMP-1 in smoker periodontitis patients provides support for the smoking associated risk of cardiovascular diseases in periodontitis patients
20634941 Results describe the direct effects of the antibiotics colistin and tobramycin on neutrophil elastase activity in cystic fibrosis patients.
20627279 Cluster analysis reveals two classes of thrombi according to neutrophil elastase -specific fibrin degradation products (NE-FDP),leukocyte and platelet content and also two according to NE-FDP, leukocyte and fibrin content.
20582973 coexistence of CN and SCN phenotypes in this kindred with a shared S97L ELANE paternal haplotype strongly suggests both a role for modifying genes in determination of congenital neutropenia disease phenotypes
20521180 variants of alpha-1-antitrypsin and ELA2 genotypes with predicted intermediate or high activity could represent a risk factor for aggressive form of lung cancer
20453419 In patients in preterm labor with a high elastase concentration in cervical secretions, treatment with urinary trypsin inhibitor reduced the risk of preterm delivery and improved neonatal outcomes.
20423453 REVIEW: structural basis for the different ligand specificities and membrane binding mechanisms of human proteinase 3 and neutrophil elastase
20411049 NE digests ferritin increasing the extracellular iron pool available for cellular uptake
20376727 Neutrophil elastase inhibitor, Sivelestat, significantly reduced the postoperative decreases in AT III and platelet count in patients undergoing emergency surgery for acute aortic dissection.
20354035 Sivelestat may attenuate neutrophil elastase or proinflammatory cytokines, and improve pulmonary dysfunction in patients undergoing cardiopulmonary bypass.
20346360 Observational study of gene-disease association. (HuGE Navigator)
20179351 ELA2 as a major new epidermal protease involved in essential pathways for skin barrier function.
20111696 Sputum samples from cystic fibrosis patients had elevated human neutrophil elastase (HNE) levels which correlated with an increased MMP-9/TIMP-1 ratio.
20033193 elevated in chronic compared to acute wounds
20007580 Secretory leucoprotease inhibitor is cleaved and inactivated by neutrophil elastase present in Pseudomonas aeruginosa-positive secretions in the cystic fibrosis lung.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19775295 Observational study of gene-disease association. (HuGE Navigator)
19763368 no consistent pattern among sites in the vagina in pelvic organ prolapse
19620402 Neutrophil elastase is severely down-regulated in severe congenital neutropenia independent of ELA2 or HAX1 mutations but dependent on LEF-1.
19620298 Neutrophil elastase is one of the mediators responsible for complement-dependent opsonophagocytic killing of Streptococcus pneumoniae by human neutrophils.
19590686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19542452 Neutrophil elastase inhibits interleukin (IL)-8/CXCL8 gene expression and protein release specifically in human airway smooth muscle cells by inducing NF-kappa B repressing factor (NRF).
19506020 Data suggest that expression of PFAAP5 allows neutrophil elastase to potentiate the repression of Gfi1 target genes.
19415009 Three cases of familial congenital neutrophenia (P13L, R52P, and S97L), 2 of familial cyclic neutropenia (W212stop and P110L), and 1 of sporadic congenital neutropenia (V72M) were shown to have heterozygous mutations in the Ela2 gene
19362143 elevated plasma levels in patients with acute myocardial infarction compared to patients with stable coronary artery disease
19307610 leukocyte elastase-induced apoptosis of lung epithelial cells is mediated by a PAR-1-triggered pathway involving activation of NF-kappaB and p53, and a PUMA- and Bax-dependent increase in mitochondrial permeability leading to activation of distal caspases
19251947 Shed syndecan-1 restricts neutrophil elastase from alpha1-antitrypsin in neutrophilic airway inflammation.
19197381 The hypothesis that an imbalance between neutrophil elastase (HNE) and its inhibitors in blood is related to the development of ARDS, was tested.
19180801 Report changes in plasma level of human leukocyte elastase during leukocytosis from physical effort.
19132232 Modulation of endothelial cell tissue factor and tissue factor pathway inhibitor-1 by neutrophil elastase.
18980523 Non-surgical periodontal treatment was effective in reducing the levels of elastase in gingival crevicular fluid from diabetic patients with chronic periodontitis.
18799464 elafin is cleaved by its cognate enzyme NE present at excessive concentration in CF sputum, an effect which is promoted by P. aeruginosa infection
18710383 Observational study of gene-disease association. (HuGE Navigator)
18669870 CD63 is involved in granule targeting of neutrophil elastase
18485588 HLE may be a natural inactivator of MMP-7 which can counteract MMP-7-induced apoptosis resistance.
18476621 MBP and NE collaborated to cause the pathological effects of nasal polyps.
18403643 This result revealed a negative feedback loop whereby CUX1 shuts down the expression of the protease that cleaves it.
18399311 total amount and the percentage of free elastase activity were significantly higher in juvenile systemic lupus erythematosus when compared with the controls
18295791 Analysis of the NE proteolytic products of the Shigella virulence factor IpaB shows that NE has specific cleavage sites.
18278188 In an in vitro atherosclerosis model neutrophil infiltration was mediated via IL-8-signalling and accompanied by release of elastase and induction of endothelial cell apoptosis.
18211966 Pre-eminent role for neutrophil elastase as the critical protease responsible for PSP-D depletion in inflammatory lung disease
18194283 PMN-elastase levels in serum and seminal plasma were not significantly correlated and there was no association with subsequent fertility.
18178964 Neutrophil elastase cleaves laminin-332 (laminin-5) generating peptides that are chemotactic for neutrophils.
18043239 Genetic evidence suggests that ELA2 mutations act in a dominant, cell-intrinsic fashion to disrupt granulopoiesis. Mutations of ELA2 may cause disease through induction of the unfolded protein response. Review.
18028488 study of severe congenital neutropenia patients; there was no significant difference in risk of myelodysplastic syndrome/acute myeloid leukaemia in patients with mutant versus wild-type ELA2
17998887 urinary trypsin inhibitor is insufficiently produced for neutrophil elastase release after cardiac arrest
17853021 Leukocyte elastase is involved in renal injury occurring in the course of primary idiopathic glomerulonephritis, in particular in the proliferative types.
17785837 Induction of murine macrophage microbicidal activity by either neutrophils or purified human neutrophil elastase requires TLR4 expression by macrophages.
17761833 ELA2 mutations result in the production of misfolded NE protein, activation of the unfolded protein response (UPR), and ultimately apoptosis of granulocytic precursors
17690184 Data suggest that polymorphonuclear leukocytes decrease dendritic cell allostimulatory ability via production of elastase leading to a switch of immature DCs into TGF-beta1-secreting cells.
17622939 Observational study of gene-disease association. (HuGE Navigator)
17622939 The association of C4890A with myocardial infarction (MI) in Belfast exclusively, and the presumed absence of its functionality, provides little support for a substantial implication of common ELA2 gene variants in overall MI risk.
17436313 An exceptional genetic phenomenon in which both a cyclic neutropenia patient and an SCN patient each possess two new ELA2 mutations; role in protein mistrafficking as disease mechanism.
17412886 The primary granule proteins elastase (ELA2) and proteinase 3 (PR3) both contain the nonapeptide PR1, which can induce cytotoxic T lymphocyte responses against chronic myeloid leukemia.
17397908 The activation of the neutrophil elastase-mediated fibrinolytic pathway may be insufficient to overcome the fibrinolytic shutdown by PAI-1 and may in part explain the poor prognosis of DIC patients associated with systemic inflammation.
17395013 NAD(P)H:quinone oxidoreductase 1has an important role as a mediator of neutrophil elastase-regulated oxidant stress and mucin 5AC mucin gene expression.
17088257 analysis of human neutrophil protease 3 and elastase active site charge distribution
17023068 The identification of annexin 1 as a substrate for HLE supports the model in which annexin 1 participates in regulating leukocyte emigration into inflamed tissue.
16690986 Neutrophil derived elastase (NE) upregulates TGF-beta1 gene expression and release via My88/IRAK/NF-kappaB pathway, possibly through activation of TLR4, and shed light on a potential role of neutrophils in the pathogenesis of asthma.
16670064 The Leu92His mutation is near the glycosylation site Asn95. This AA substitution may alter the availability of this Asn residue resulting in abnormal glycosylation of the mutant protein.
16624642 C-reactive protein degradation products generated by neutrophil elastase promote neutrophil apoptosis
16551967 cells expressing mutant HNE exhibited a significant increase in apoptosis associated with up-regulation of master ER chaperone BiP, indicating that disturbance of intracellular trafficking results in activation of the mammalian unfolded protein response
16321984 comparison of x-ray structures of alpha1PI complexes with trypsin, PPE, and human neutrophil elastase
16282197 These data suggest that hypertonic saline upregulates polymorphonuclear neutrophil degranulation via ATP release and positive feedback through P2 and A3 receptors.
16244764 granulocyte-derived elastase is a potentially useful marker for the diagnosis of overt-disseminated intravascular coagulation and as a predictor of organ failure-related outcome
16148149 HNE causes protein kinase C (PKC) activation and translocation from cytosol to plasma membrane, required for HNE-induced ROS generation and other responses
16127146 HNE stimulation of mucin release by human airway epithelial cells involves intracellular activation of PKC, specifically the delta isoform.
16079102 Patients with cyclic neutropenia and agranulocytosis showed mutations in this enzyme.
15941909 human AML cells constitutively secrete and express SDF-1-dependent cell-surface elastase, which regulates their migration and proliferation
15892999 Observational study of gene-disease association. (HuGE Navigator)
15718918 elastase binds to the beta(2)-integrin CD11b and induces a conformational alteration of CD11b
15657182 data suggest mechanisms by which NE mutations cause neutropenia and suggest that abnormal protein trafficking and accelerated apoptosis of differentiating myeloid cells contribute to the severe congenital neutropenia phenotype of the G185R mutation.
15614130 Neutrophil elastase, MIP-2, and TLR-4 have roles in progression of human sepsis and murine peritonitis
15601827 Neutrophil elastase has a role in PML-retinoic acid receptor alpha activities in early myeloid cells
15595387 secreted E coliO78 OmpA can play a role in protection of bacteria from NE by competitive inhibition
15161642 elastase released by polymorphonuclear leukocytes trapped within the mural thrombus impairs the spontaneous anchorage of mesenchymal cells to a fibrin matrix
15140022 Release of human leukocyte elastase from neutrophils specifically down-regulates the responsiveness of neutrophils to C5a, and this effect may play a role in the down-regulation of acute inflammation.
15131125 neutrophil elastase and cathepsin G are inhibited by PAI-1 mutants
15059607 neutrophil elastase mutations play a role in human hereditary neutropenia, as shown in a dog model [review]
15010259 Results demonstrate that human neutrophil elastase is mitogenic for airway smooth muscle cells by increasing cyclin D1 activity through the mitogen-activated protein kinase signaling pathway.
14962902 Observational study of gene-disease association. (HuGE Navigator)
14962902 the expression of neutropenia in cyclic and severe congenital neutropenia may be either homogeneous or variable according to the type of mutations, suggesting different pathogenetic mechanisms.
14730209 Results indicate that neutrophil elastase activates p38 MAP kinase which upregulates NF-kappaB and AP-1 activities, thus inducing interleukin-8 mRNA expression and protein synthesis.
14705961 An important part of the antimicrobial mechanism of neutrophil elastase may be a periplasmic bacteriostatic effect of protease that has translocated across the damaged outer membrane.
14688365 Serine proteinases neutrophil elastase and cathepsin G cooperate for the proteolytic regulation of CD87/urokinase receptor on monocytic cells.
14636558 Since NE is maximally produced in promyelocytes, this protease may play a role in APL pathogenesis by facilitating the leukemogenic potential of PML-RARalpha
14587040 NE-induced degradation of G-CSG and G-CSFR correlates with a reduction in the biologic activity of the cytokine and a decrease in the signaling function of the receptor because of decreased G-CSFR surface expression.
12934194 NE levels in infected lobes were higher than those in uninvolved lobes, and NE levels were significantly elevated in both, compared with that in control lobes in community acquired pneumonia
12933574 Human leukocyte elastase (HLE) interacts with the fusion motif (residues 491-495) of HIV-1 gp41, suggesting a nonenzymatic receptor function for HLE in the context of HIV-1 entry into cells
12893759 elastase overproduction by the leukemic clone can change the growth environment by digesting growth factors, thereby giving advantage to Ph+ hematopoiesis
12887060 the effect of kininogen degradation by human neutrophil elastase (HNE) on kinin generation
12876407 in vitro challenge of neutrophils in asthmatic patients with allergens to which the patients were sensitive elicited a release of elastase by these cells. The in vitro activation of neutrophils was highly allergen specific.
12853121 Multimeric SFTPD was partially digested by ELA2 dose- and time-dependently with loss of its carbohydrate recognition domain.
12782302 Neutrophil elastase up-regulates interleukin-8 via toll-like receptor 4
12778173 Mutations in proto-oncogene GFI1 cause human neutropenia and target ELA2
12771009 Fibrous and atheromatous plaques but not normal arteries contained NE; NE abounded in the macrophage-rich shoulders of atheromatous plaques with features of vulnerability. Neutrophil elastase and macrophages colocalized in such vulnerable plaques
12745650 Review. Heterozygous mutations in the ELA2 gene have been described in cyclical & congenital neutropenia. A case of paternal mosaicism has provided genetic "proof" of the pathogenicity of such mutations.
12700588 adherent PMNs induce a localized, sequential disassembly of endothelial adherens junctions, which is partially mediated by PMN-derived elastase
12483111 REVIEW: role of ela2 germline mutations in inherited neutropenia, gene feedback circuits, signalling genetics, and proposal that neutrophil elastase acts as an inhibitor of myelopoiesis
12444202 Protease entry results in direct cleavage of p65 NF-kappaB in the N-terminal region by PR3 and in the C-terminal region by HNE. PR3 and HNE have specific, fundamental roles in endothelial responses during inflammation.
12393522 Neutrophil elastase plays a role in providing negative feedback to granulopoiesis by direct antagonism of G-CSF.
12223522 Treatment of human gingival fibroblasts with human leukocyte elastase down-regulated CD40 expression & binding to CD40 ligand. CD40 reduction by direct proteolysis by HLE was seen in skin & lung fibroblasts (not monocytes, macrophages, & dendritic cells).
12183836 plasma levels are increased during G-CSF induced hematopoietic stem cell mobilization
12114510 HNE plays a role in neutrophil response to inflammation
12091371 Precursor cells containing the ELA2 mutation are selectively lost during myelopoiesis or fail to develop into neutrophils, confirming the pathogenic nature of elastase mutations in humans.
12083479 degraded scu-PA and also tcu-PA, t-PA and plasmin, resulting in loss of fibrinolytic activity
12042033 Neutrophil elastase-induced overexpression of mucin genes in cultured tumor cells is inhibited by a retinoic acid receptor alpha antagonist.
12020136 Elastase is mainly responsible for cartilage damage by stimulated human neutrophils, as demonstrated by the use of selective elastase inhibitors.
11948122 Observational study of gene-disease association. (HuGE Navigator)
11928814 UVA light stimulates the production of neutrophil elastase by dermal fibroblasts: a possible contribution to the remodeling of elastotic areas in sun-damaged skin.
11846296 Mutant neutrophil elastase induces accelerated apoptosis of promyelocytes, leading to maturation arrest in congenital and cyclic neutropenia.

AA Sequence

MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAH      1 - 70
CVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPA     71 - 140
QGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNG    141 - 210
LIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH                 211 - 267
//

Text Mined References (244)

PMID Year Title
26567890 2016 ELANE mutant-specific activation of different UPR pathways in congenital neutropenia.
26444279 2016 Increased ratio of neutrophil elastase to ?1-antitrypsin is closely associated with liver inflammation in patients with nonalcoholic steatohepatitis.
26372354 2015 Polar Desolvation and Position 226 of Pancreatic and Neutrophil Elastases Are Crucial to their Affinity for the Kunitz-Type Inhibitors ShPI-1 and ShPI-1/K13L.
26269588 2015 Neutrophil elastase promotes interleukin-1? secretion from human coronary endothelium.
26221769 2016 Alpha-1 Antitrypsin Mitigates the Inhibition of Airway Epithelial Cell Repair by Neutrophil Elastase.
26193632 2015 Pathogenesis of ELANE-mutant severe neutropenia revealed by induced pluripotent stem cells.
26174650 2015 Paternal Somatic Mosaicism of a Novel Frameshift Mutation in ELANE Causing Severe Congenital Neutropenia.
26018813 2015 Measurement of C-reactive protein, procalcitonin and neutrophil elastase in saliva of COPD patients and healthy controls: correlation to self-reported wellbeing parameters.
25956321 2015 Monocytic elastase-mediated apolipoprotein-E degradation: Potential involvement of microglial elastase-like proteases in apolipoprotein-E proteolysis in brains with Alzheimers disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25912133 2015 Mosaicism of an ELANE mutation in an asymptomatic mother in a familial case of cyclic neutropenia.
25893670 2015 Production of IL-8, VEGF and Elastase by Circulating and Intraplaque Neutrophils in Patients with Carotid Atherosclerosis.
25878251 2015 Neutrophil Elastase Activates Protease-activated Receptor-2 (PAR2) and Transient Receptor Potential Vanilloid 4 (TRPV4) to Cause Inflammation and Pain.
25857284 2015 Autoprocessing of neutrophil elastase near its active site reduces the efficiency of natural and synthetic elastase inhibitors.
25666548 2015 Sirtinol inhibits neutrophil elastase activity and attenuates lipopolysaccharide-mediated acute lung injury in mice.
25652853 2015 [Over-expression of neutrophil elastase promotes proliferation and inhibits apoptosis in K562 cells].
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25465717 2015 Mechanism of tissue factor production by monocytes stimulated with neutrophil elastase.
25427142 2015 The diversity of mutations and clinical outcomes for ELANE-associated neutropenia.
25284053 2015 Urine, peritoneal fluid and omental fat proteomes of reproductive age women: Endometriosis-related changes and associations with endocrine disrupting chemicals.
25248056 Quantitative analysis of elastase and cathepsin G mRNA levels in peripheral blood CD14(+) cells from patients with rheumatoid arthritis.
25195861 2015 The serine protease inhibitor elafin maintains normal growth control by opposing the mitogenic effects of neutrophil elastase.
25162927 2015 Clinical characteristics of severe congenital neutropenia caused by novel ELANE gene mutations.
25092677 2014 Increased neutrophil elastase and proteinase 3 and augmented NETosis are closely associated with ?-cell autoimmunity in patients with type 1 diabetes.
24929239 2014 Unopposed cathepsin G, neutrophil elastase, and proteinase 3 cause severe lung damage and emphysema.
24914212 2014 An interactive network of elastase, secretases, and PAR-2 protein regulates CXCR1 receptor surface expression on neutrophils.
24877096 2014 Elastase and cathepsin G from primed leukocytes cleave vascular endothelial cadherin in hemodialysis patients.
24848868 2014 Pseudomonas aeruginosa elastase disrupts the cortisol-binding activity of corticosteroid-binding globulin.
24816969 2014 Neutrophil elastase gene polymorphisms: modulators of response to therapy in childhood bronchiectasis?
24616599 2014 Different clinical phenotypes in familial severe congenital neutropenia cases with same mutation of the ELANE gene.
24513040 2014 Neutrophil elastase-dependent cleavage compromises the tumor suppressor role of EMILIN1.
24184683 2014 Neutropenia-associated ELANE mutations disrupting translation initiation produce novel neutrophil elastase isoforms.
24052258 2013 Neutrophil elastase and proteinase-3 trigger G protein-biased signaling through proteinase-activated receptor-1 (PAR1).
24023624 2013 Solar ultraviolet irradiation induces decorin degradation in human skin likely via neutrophil elastase.
23911525 2013 A new proteinase 3 substrate with improved selectivity over human neutrophil elastase.
23819644 2013 Activity of neutrophil elastase reflects the progression of acute pancreatitis.
23741370 2013 Human neutrophil elastase degrades SPLUNC1 and impairs airway epithelial defense against bacteria.
23692169 2013 Risk factors for bronchiectasis in children with cystic fibrosis.
23564510 2013 Human neutrophil elastase-mediated goblet cell metaplasia is attenuated in TACE-deficient mice.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23463630 2013 The spectrum of ELANE mutations and their implications in severe congenital and cyclic neutropenia.
23454784 2013 Different pattern of gene mutations in Iranian patients with severe congenital neutropenia (including 2 new mutations).
23392769 2013 Neutrophil elastase induces MUC5AC secretion via protease-activated receptor 2.
23351986 2013 ELANE mutations in cyclic and severe congenital neutropenia: genetics and pathophysiology.
23001948 2012 Polymorphonuclear neutrophils promote dyshesion of tumor cells and elastase-mediated degradation of E-cadherin in pancreatic tumors.
22996420 2013 The neutrophil elastase mutant affects viability and differentiation of the human monocytic THP-1 cell.
22993338 2012 SERPINA1 and ELA2 polymorphisms are not associated with COPD or lung cancer.
22918834 2012 Amyloid fibrils trigger the release of neutrophil extracellular traps (NETs), causing fibril fragmentation by NET-associated elastase.
22915586 2012 Clathrin pit-mediated endocytosis of neutrophil elastase and cathepsin G by cancer cells.
22683569 2012 Neonatal mice genetically modified to express the elastase inhibitor elafin are protected against the adverse effects of mechanical ventilation on lung growth.
22500123 2012 Alveolar fractal box dimension inversely correlates with mean linear intercept in mice with elastase-induced emphysema.
22407864 2012 Inhibition of neutrophil elastase and metalloprotease-9 of human adenocarcinoma gastric cells by chamomile (Matricaria recutita L.) infusion.
22174830 2011 Neutrophil elastase enhances sputum solubilization in cystic fibrosis patients receiving DNase therapy.
21979170 2012 Neutrophil elastase cleaves the murine hemidesmosomal protein BP180/type XVII collagen and generates degradation products that modulate experimental bullous pemphigoid.
21843618 2011 Exploring Tagetes erecta Linn flower for the elastase, hyaluronidase and MMP-1 inhibitory activity.
21796505 2011 Mutations in the ELANE gene are associated with development of periodontitis in patients with severe congenital neutropenia.
21731773 2011 Mechanism of heparin acceleration of tissue inhibitor of metalloproteases-1 (TIMP-1) degradation by the human neutrophil elastase.
21605276 2011 Plasma neutrophil elastase correlates with pulmonary vascular permeability: a prospective observational study in patients with pneumonia.
21576245 2011 Neutrophil elastase acts as a biased agonist for proteinase-activated receptor-2 (PAR2).
21488974 2011 Sensor materials for the detection of human neutrophil elastase and cathepsin G activity in wound fluid.
21477798 2011 Neutrophil elastase treated dendritic cells promote the generation of CD4(+)FOXP3(+) regulatory T cells in vitro.
21475777 2011 Mechanisms of human neutrophil elastase-catalysed inactivation of factor VIII(a).
21448199 2011 Congenital neutropenia in a newborn.
21425445 2011 Four novel ELANE mutations in patients with congenital neutropenia.
21269460 2011 Initial characterization of the human central proteome.
21236472 2011 Degradation of cross-linked fibrin by leukocyte elastase as alternative pathway for plasmin-mediated fibrinolysis in sepsis-induced disseminated intravascular coagulation.
21206270 2011 Genetic etiologies of severe congenital neutropenia.
21193404 2011 Pulmonary proteases in the cystic fibrosis lung induce interleukin 8 expression from bronchial epithelial cells via a heme/meprin/epidermal growth factor receptor/Toll-like receptor pathway.
20974816 2010 Neutrophil elastase and myeloperoxidase regulate the formation of neutrophil extracellular traps.
20932306 2010 Effect of neutrophil elastase and its inhibitor EPI-hNE4 on transepithelial sodium transport across normal and cystic fibrosis human nasal epithelial cells.
20883273 2010 Neutrophil elastase promotes proliferation of HaCaT cell line and transwell psoriasis organ culture model.
20828556 2010 Neutrophil elastase and proteinase 3 trafficking routes in myelomonocytic cells.
20803142 2011 Severe congenital neutropenia in a multigenerational family with a novel neutrophil elastase (ELANE) mutation.
20646231 2011 Smoking and matrix metalloproteinases, neutrophil elastase and myeloperoxidase in chronic periodontitis.
20634941 2010 In vitro inhibition of neutrophil elastase activity by inhaled anti-Pseudomonas antibiotics used in cystic fibrosis patients.
20627279 2010 Contribution of neutrophil elastase to the lysis of obliterative thrombi in the context of their platelet and fibrin content.
20582973 2010 Cyclic neutropenia and severe congenital neutropenia in patients with a shared ELANE mutation and paternal haplotype: evidence for phenotype determination by modifying genes.
20521180 2011 Alpha-1-antitrypsin phenotypes and neutrophil elastase gene promoter polymorphisms in lung cancer.
20453419 2010 Effect of urinary trypsin inhibitor on preterm labor with high granulocyte elastase concentration in cervical secretions.
20423453 2010 Structures of human proteinase 3 and neutrophil elastase--so similar yet so different.
20411049 2009 Neutrophil elastase increases airway epithelial nonheme iron levels.
20376727 2010 Efficacy of neutrophil elastase inhibitor on type A acute aortic dissection.
20354035 2010 Effect of a neutrophil elastase inhibitor on acute lung injury after cardiopulmonary bypass.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20220065 2010 Digenic mutations in severe congenital neutropenia.
20179351 2010 Elastase 2 is expressed in human and mouse epidermis and impairs skin barrier function in Netherton syndrome through filaggrin and lipid misprocessing.
20111696 Human neutrophil elastase-mediated cleavage sites of MMP-9 and TIMP-1: implications to cystic fibrosis proteolytic dysfunction.
20033193 2010 Protease and pro-inflammatory cytokine concentrations are elevated in chronic compared to acute wounds and can be modulated by collagen type I in vitro.
20007580 2009 Decreased levels of secretory leucoprotease inhibitor in the Pseudomonas-infected cystic fibrosis lung are due to neutrophil elastase degradation.
19927291 2010 Pegfilgrastim in children with severe congenital neutropenia.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19775295 2009 Prevalence of mutations in ELANE, GFI1, HAX1, SBDS, WAS and G6PC3 in patients with severe congenital neutropenia.
19763368 2009 Is lysyl oxidase-like protein-1, alpha-1 antitrypsin, and neutrophil elastase site specific in pelvic organ prolapse?
19620402 2009 Neutrophil elastase is severely down-regulated in severe congenital neutropenia independent of ELA2 or HAX1 mutations but dependent on LEF-1.
19620298 2009 Human neutrophils kill Streptococcus pneumoniae via serine proteases.
19590686 2009 Postural changes in blood pressure associated with interactions between candidate genes for chronic respiratory diseases and exposure to particulate matter.
19542452 2009 Neutrophil elastase represses IL-8/CXCL8 synthesis in human airway smooth muscle cells through induction of NF-kappa B repressing factor.
19506020 2009 Contributions to neutropenia from PFAAP5 (N4BP2L2), a novel protein mediating transcriptional repressor cooperation between Gfi1 and neutrophil elastase.
19415009 2009 Ela2 mutations and clinical manifestations in familial congenital neutropenia.
19362143 2009 Neutrophil activation precedes myocardial injury in patients with acute myocardial infarction.
19307610 2009 Leukocyte elastase induces lung epithelial apoptosis via a PAR-1-, NF-kappaB-, and p53-dependent pathway.
19251947 2009 Shed syndecan-1 restricts neutrophil elastase from alpha1-antitrypsin in neutrophilic airway inflammation.
19197381 2009 Plasma neutrophil elastase and elafin imbalance is associated with acute respiratory distress syndrome (ARDS) development.
19180801 2003 Changes in plasma level of human leukocyte elastase during leukocytosis from physical effort.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19132232 2008 Modulation of tissue factor and tissue factor pathway inhibitor-1 by neutrophil proteases.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19036076 2009 Homozygous HAX1 mutations in severe congenital neutropenia patients with sporadic disease: a novel mutation in two unrelated British kindreds.
18980523 2008 The short-term effectiveness of non-surgical treatment in reducing levels of interleukin-1beta and proteases in gingival crevicular fluid from patients with type 2 diabetes mellitus and chronic periodontitis.
18946670 2009 A novel mutation Ala57Val of the ELA2 gene in a Korean boy with severe congenital neutropenia.
18799464 2008 Elafin, an elastase-specific inhibitor, is cleaved by its cognate enzyme neutrophil elastase in sputum from individuals with cystic fibrosis.
18710383 2008 Duffy (Fy), DARC, and neutropenia among women from the United States, Europe and the Caribbean.
18669870 2008 The tetraspanin CD63 is involved in granule targeting of neutrophil elastase.
18485588 2008 Human leukocyte elastase counteracts matrix metalloproteinase-7 induced apoptosis resistance of tumor cells.
18476621 2008 [Expression of eosinophil major basic protein and neutrophil elastase in nasal polyp tissue and secretion].
18403643 2008 Proteolytic processing of cut homeobox 1 by neutrophil elastase in the MV4;11 myeloid leukemia cell line.
18399311 2008 Higher elastase activity associated with lower IL-18 in GCF from juvenile systemic lupus patients.
18295791 2008 Single residue determines the specificity of neutrophil elastase for Shigella virulence factors.
18278188 2008 Subendothelial infiltration of neutrophil granulocytes and liberation of matrix-destabilizing enzymes in an experimental model of human neo-intima.
18211966 2008 Patterns of neutrophil serine protease-dependent cleavage of surfactant protein D in inflammatory lung disease.
18194283 2009 Clinical relevance of polymorphonuclear (PMN-) elastase determination in semen and serum during infertility investigation.
18178964 2008 Neutrophil elastase cleaves laminin-332 (laminin-5) generating peptides that are chemotactic for neutrophils.
18043239 2008 Severe congenital neutropenia and the unfolded protein response.
18028488 2008 Neutrophil elastase mutations and risk of leukaemia in severe congenital neutropenia.
17998887 2008 Insufficient production of urinary trypsin inhibitor for neutrophil elastase release after cardiac arrest.
17853021 2007 Elastase deposits in the kidney and urinary elastase excretion in patients with glomerulonephritis--evidence for neutrophil involvement in renal injury.
17785837 2007 Neutrophils activate macrophages for intracellular killing of Leishmania major through recruitment of TLR4 by neutrophil elastase.
17761833 2007 Mutations of the ELA2 gene found in patients with severe congenital neutropenia induce the unfolded protein response and cellular apoptosis.
17690184 2007 Neutrophil elastase converts human immature dendritic cells into transforming growth factor-beta1-secreting cells and reduces allostimulatory ability.
17622939 2007 Neutrophil elastase gene variation and coronary heart disease.
17436313 2007 Double de novo mutations of ELA2 in cyclic and severe congenital neutropenia.
17412886 2007 High PR3 or ELA2 expression by CD34+ cells in advanced-phase chronic myeloid leukemia is associated with improved outcome following allogeneic stem cell transplantation and may improve PR1 peptide-driven graft-versus-leukemia effects.
17397908 2007 The activation of neutrophil elastase-mediated fibrinolysis is not sufficient to overcome the fibrinolytic shutdown of disseminated intravascular coagulation associated with systemic inflammation.
17395013 2007 Regulation of MUC5AC expression by NAD(P)H:quinone oxidoreductase 1.
17187068 2007 HAX1 deficiency causes autosomal recessive severe congenital neutropenia (Kostmann disease).
17088257 2007 Influence of charge distribution at the active site surface on the substrate specificity of human neutrophil protease 3 and elastase. A kinetic and molecular modeling analysis.
17023068 2006 Proteolytic cleavage of annexin 1 by human leukocyte elastase.
16690986 2006 Neutrophil-derived elastase induces TGF-beta1 secretion in human airway smooth muscle via NF-kappaB pathway.
16670064 2006 Neutrophil elastase and granulocyte colony-stimulating factor receptor mutation analyses and leukemia evolution in severe congenital neutropenia patients belonging to the original Kostmann family in northern Sweden.
16624642 2006 C-reactive protein products generated by neutrophil elastase promote neutrophil apoptosis.
16551967 2006 Mutations in neutrophil elastase causing congenital neutropenia lead to cytoplasmic protein accumulation and induction of the unfolded protein response.
16321984 2006 Active site distortion is sufficient for proteinase inhibition by serpins: structure of the covalent complex of alpha1-proteinase inhibitor with porcine pancreatic elastase.
16282197 2006 Hypertonic saline enhances neutrophil elastase release through activation of P2 and A3 receptors.
16244764 2005 Elevated plasma levels of fibrin degradation products by granulocyte-derived elastase in patients with disseminated intravascular coagulation.
16148149 2005 Neutrophil elastase induces MUC5AC mucin production in human airway epithelial cells via a cascade involving protein kinase C, reactive oxygen species, and TNF-alpha-converting enzyme.
16127146 2005 Human neutrophil elastase induces hypersecretion of mucin from well-differentiated human bronchial epithelial cells in vitro via a protein kinase C{delta}-mediated mechanism.
16079102 2005 A comparison of the defective granulopoiesis in childhood cyclic neutropenia and in severe congenital neutropenia.
15941909 2005 Motility, proliferation, and egress to the circulation of human AML cells are elastase dependent in NOD/SCID chimeric mice.
15892999 2005 Polymorphisms in the promoter region of neutrophil elastase gene and lung cancer risk.
15718918 2005 Expression of elastase on polymorphonuclear neutrophils in vitro and in vivo: identification of CD11b as ligand for the surface-bound elastase.
15657182 2005 Aberrant subcellular targeting of the G185R neutrophil elastase mutant associated with severe congenital neutropenia induces premature apoptosis of differentiating promyelocytes.
15614130 2005 Neutrophil elastase, MIP-2, and TLR-4 expression during human and experimental sepsis.
15601827 2005 Neutrophil elastase is important for PML-retinoic acid receptor alpha activities in early myeloid cells.
15595387 2004 OmpA of a septicemic Escherichia coli O78--secretion and convergent evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245434 2004 Human leukocyte elastase induces keratinocyte proliferation by epidermal growth factor receptor activation.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15161642 2004 Role of leukocyte elastase in preventing cellular re-colonization of the mural thrombus.
15140022 2004 Human leukocyte elastase and cathepsin G are specific inhibitors of C5a-dependent neutrophil enzyme release and chemotaxis.
15131125 2004 Mutants of plasminogen activator inhibitor-1 designed to inhibit neutrophil elastase and cathepsin G are more effective in vivo than their endogenous inhibitors.
15059607 2004 Hereditary neutropenia: dogs explain human neutrophil elastase mutations.
15010259 2004 Human neutrophil-derived elastase induces airway smooth muscle cell proliferation.
14962902 2004 Mutations in the ELA2 gene correlate with more severe expression of neutropenia: a study of 81 patients from the French Neutropenia Register.
14730209 Neutrophil elastase induces IL-8 synthesis by lung epithelial cells via the mitogen-activated protein kinase pathway.
14705961 2004 The periplasmic serine protease inhibitor ecotin protects bacteria against neutrophil elastase.
14688365 2004 Proteolytic regulation of the urokinase receptor/CD87 on monocytic cells by neutrophil elastase and cathepsin G.
14673143 2004 A novel notch protein, N2N, targeted by neutrophil elastase and implicated in hereditary neutropenia.
14636558 2003 Neutrophil elastase cleaves PML-RARalpha and is important for the development of acute promyelocytic leukemia in mice.
14587040 2003 Proteolytic cleavage of granulocyte colony-stimulating factor and its receptor by neutrophil elastase induces growth inhibition and decreased cell surface expression of the granulocyte colony-stimulating factor receptor.
12934194 2003 Local impairment of anti-neutrophil elastase capacity in community-acquired pneumonia.
12893759 2003 Clonal dominance of chronic myelogenous leukemia is associated with diminished sensitivity to the antiproliferative effects of neutrophil elastase.
12887060 2003 Attenuated kinin release from human neutrophil elastase-pretreated kininogens by tissue and plasma kallikreins.
12876407 2003 Specific allergens enhance elastase release in stimulated neutrophils from asthmatic patients.
12853121 2003 Limited proteolysis of surfactant protein D causes a loss of its calcium-dependent lectin functions.
12782302 2003 Neutrophil elastase up-regulates interleukin-8 via toll-like receptor 4.
12778173 2003 Mutations in proto-oncogene GFI1 cause human neutropenia and target ELA2.
12771009 2003 Neutrophil elastase in human atherosclerotic plaques: production by macrophages.
12745650 2003 Neutrophil elastase mutations in congenital neutropenia.
12700588 2003 Neutrophils induce sequential focal changes in endothelial adherens junction components: role of elastase.
12538645 2003 Compared action of neutrophil proteinase 3 and elastase on model substrates. Favorable effect of S'-P' interactions on proteinase 3 catalysts.
12531874 2003 Disruption of the CXCR4/CXCL12 chemotactic interaction during hematopoietic stem cell mobilization induced by GCSF or cyclophosphamide.
12526812 2002 Conversion of proepithelin to epithelins: roles of SLPI and elastase in host defense and wound repair.
12483111 2003 Role of neutrophil elastase in bone marrow failure syndromes: molecular genetic revival of the chalone hypothesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444202 2002 Novel effects of neutrophil-derived proteinase 3 and elastase on the vascular endothelium involve in vivo cleavage of NF-kappaB and proapoptotic changes in JNK, ERK, and p38 MAPK signaling pathways.
12393522 2003 Neutrophil elastase enzymatically antagonizes the in vitro action of G-CSF: implications for the regulation of granulopoiesis.
12223522 2002 Disruption of CD40/CD40 ligand interaction with cleavage of CD40 on human gingival fibroblasts by human leukocyte elastase resulting in down-regulation of chemokine production.
12190311 2002 Discovery of further pyrrolidine trans-lactams as inhibitors of human neutrophil elastase (HNE) with potential as development candidates and the crystal structure of HNE complexed with an inhibitor (GW475151).
12183836 2002 Proteolytic enzyme levels are increased during granulocyte colony-stimulating factor-induced hematopoietic stem cell mobilization in human donors but do not predict the number of mobilized stem cells.
12117418 2002 Structural and functional characterization of tissue factor pathway inhibitor following degradation by matrix metalloproteinase-8.
12114510 2002 Discriminating between the activities of human neutrophil elastase and proteinase 3 using serpin-derived fluorogenic substrates.
12091371 2002 Paternal mosaicism proves the pathogenic nature of mutations in neutrophil elastase in severe congenital neutropenia.
12083479 2002 Polymorphonuclear leucocytes have two opposing roles in fibrinolysis.
12068293 2002 G-CSF induces stem cell mobilization by decreasing bone marrow SDF-1 and up-regulating CXCR4.
12042033 2002 Overexpression of mucin genes induced by interleukin-1 beta, tumor necrosis factor-alpha, lipopolysaccharide, and neutrophil elastase is inhibited by a retinoic acid receptor alpha antagonist.
11948122 2002 Polymorphisms in the promoter region of the neutrophil elastase gene are associated with lung cancer development.
11928814 2002 UVA light stimulates the production of cathepsin G and elastase-like enzymes by dermal fibroblasts: a possible contribution to the remodeling of elastotic areas in sun-damaged skin.
11907569 2002 Killing activity of neutrophils is mediated through activation of proteases by K+ flux.
11846296 2001 Clinical implications of mutations of neutrophil elastase in congenital and cyclic neutropenia.
11675333 2001 Mutations in the ELA2 gene encoding neutrophil elastase are present in most patients with sporadic severe congenital neutropenia but only in some patients with the familial form of the disease.
11520773 2001 Vascular cell adhesion molecule-1 (CD106) is cleaved by neutrophil proteases in the bone marrow following hematopoietic progenitor cell mobilization by granulocyte colony-stimulating factor.
11389039 2001 Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3.
11001877 2000 Mutations in the gene encoding neutrophil elastase in congenital and cyclic neutropenia.
10924364 2000 Mutations on the hinge region of leukocyte elastase inhibitor determine the loss of inhibitory function.
10867014 2000 Oxidation of either methionine 351 or methionine 358 in alpha 1-antitrypsin causes loss of anti-neutrophil elastase activity.
10859319 2000 Matrix metalloproteinases cleave tissue factor pathway inhibitor. Effects on coagulation.
10702419 2000 Anti-inflammatory effects of mutant forms of secretory leukocyte protease inhibitor.
10581030 1999 Mutations in ELA2, encoding neutrophil elastase, define a 21-day biological clock in cyclic haematopoiesis.
10512713 1999 Cloning and characterization of hurpin (protease inhibitor 13): A new skin-specific, UV-repressible serine proteinase inhibitor of the ovalbumin serpin family.
10471600 1999 Modulation of elastase binding to elastin by human alveolar macrophage-derived lipids.
10102815 1999 Two distinct cytokines released from a human aminoacyl-tRNA synthetase.
9565572 1998 Syndecans, heparan sulfate proteoglycans, maintain the proteolytic balance of acute wound fluids.
9242537 1997 Human neutrophil elastase activates human factor V but inactivates thrombin-activated human factor V.
9124593 1997 Cytokines regulate membrane-bound leukocyte elastase on neutrophils: a novel mechanism for effector activity.
9111002 1997 Polymorphonuclear cells isolated from human peripheral blood cleave lipoprotein(a) and apolipoprotein(a) at multiple interkringle sites via the enzyme elastase. Generation of mini-Lp(a) particles and apo(a) fragments.
8864963 1996 Functional and metabolic differences between elastase-generated fragments of human lipoprotein[a] and apolipoprotein[a].
8718849 1996 Structural change in alpha-chymotrypsin induced by complexation with alpha 1-antichymotrypsin as seen by enhanced sensitivity to proteolysis.
8463250 1993 Thrombospondin is a tight-binding competitive inhibitor of neutrophil elastase.
8011628 1994 Conversion of alpha 1-antichymotrypsin into a human neutrophil elastase inhibitor: demonstration of variants with different association rate constants, stoichiometries of inhibition, and complex stabilities.
7897245 1995 Use of proteinase 3 purified by reverse phase HPLC to detect autoantibodies in systemic vasculitis.
7713495 1994 The human Met-ase gene (GZMM): structure, sequence, and close physical linkage to the serine protease gene cluster on 19p13.3.
7521069 1994 Effect of type-1 plasminogen activator inhibitor on human leukocyte elastase.
6980881 1982 Proteolytic cleavage and inactivation of alpha 2-plasmin inhibitor and C1 inactivator by human polymorphonuclear leukocyte elastase.
3640709 1986 X-ray crystal structure of the complex of human leukocyte elastase (PMN elastase) and the third domain of the turkey ovomucoid inhibitor.
3550808 1987 Primary structure of human neutrophil elastase.
3479752 1987 Nucleotide sequence of human bone marrow serine protease (medullasin) gene.
3427074 1987 Primary structure of human pancreatic elastase 2 determined by sequence analysis of the cloned mRNA.
3422232 1988 Myelomonocytic cell lineage expression of the neutrophil elastase gene.
3391280 1988 The refined 2.3 A crystal structure of human leukocyte elastase in a complex with a valine chloromethyl ketone inhibitor.
2911584 1989 Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-A resolution.
2902087 1988 Structure of the human neutrophil elastase gene.
2822677 1987 Molecular cloning of complementary DNA for human medullasin: an inflammatory serine protease in bone marrow cells.
2775493 1989 The human neutrophil elastase gene. Analysis of the nucleotide sequence reveals three distinct classes of repetitive DNA.
2681419 1989 Elastase and cathepsin G of human monocytes. Quantification of cellular content, release in response to stimuli, and heterogeneity in elastase-mediated proteolytic activity.
2538548 1989 Expression of the neutrophil elastase gene during human bone marrow cell differentiation.
2501794 1989 Antibiotic proteins of human polymorphonuclear leukocytes.
2462434 1988 Molecular cloning of human neutrophil elastase.
2437112 1987 The reactive site of human alpha 2-antiplasmin.
2322278 1990 Functional expression of human leukocyte elastase (HLE)/medullasin in eukaryotic cells.
2318847 1990 Interaction of heparin cofactor II with neutrophil elastase and cathepsin G.
2164060 1990 Elastase and cathepsin G of human monocytes: heterogeneity and subcellular localization to peroxidase-positive granules.
1859409 1991 The primary structure and elastinolytic activity of medullasin (a serine protease of bone marrow).
1558967 1992 The effect of leukocyte elastase on tissue factor pathway inhibitor.
1518849 1992 Three human elastase-like genes coordinately expressed in the myelomonocyte lineage are organized as a single genetic locus on 19pter.