Property Summary

NCBI Gene PubMed Count 84
PubMed Score 142.04
PubTator Score 178.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Animal Mammary Neoplasms 136
Disease Target Count P-value
psoriasis 6694 2.6e-04
Disease Target Count Z-score Confidence
Retinitis pigmentosa 14 7 3.894 1.9
Cancer 2499 3.049 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.6e-04

Gene RIF (59)

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA     71 - 140
MTEEAAVAIKAMAK                                                            141 - 154
//

Text Mined References (92)

PMID Year Title