Property Summary

NCBI Gene PubMed Count 79
PubMed Score 144.60
PubTator Score 178.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 2.6e-04
Disease Target Count Z-score Confidence
Cancer 2346 3.045 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 2.6e-04

Gene RIF (54)

PMID Text
26773503 Our results suggest that functional, hypusinated eIF5A is necessary for HIF-1alpha expression during hypoxia and that eIF5A is an attractive target for cancer therapy.
26483550 findings also implicate the eIF5A/RhoA/ROCK module as a potential new therapeutic target to treat metastatic PDAC cells
25979826 eIF5A has been shown to regulate a number of gene products specifically, termed the eIF5A regulon, and its role in translating proline-rich sequences has recently been identified.
25874870 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
25261239 eIF5A proteins utilize PEAK1 as a downstream effector to drive pancreatic ductal adenocarcinoma (PDAC) pathogenesis.
25218134 Mature eIF5A (hypusinated form) is not involved in the autophagic pathway.
24491565 Data suggest a regulatory mechanism for the pro-apoptotic protein eukaryotic translation initiation factor 5A1 (eIF5A1) in which its level is possibly modulated by NF-kappaB in lung cells.
24402910 The findings that eIF5A and EF-P are important for specific cellular processes and play a role in the relief of ribosome stalling caused by specific amino acid sequences
24220243 mature eIF5A controls a translational network of cancer-driving genes, termed the eIF5A regulon, at the levels of mRNA abundance and translation
23991020 Data indicate that the signal of EIF5A2, MYCN, and MCL1 genes is decreased in hydroxyurea (HU) and gemcitabine (GEM) treated UACC-1598 ovarian cancer cell line.
23733422 The expression of eIF5A-2 was up-regulated following EMT phenotype changes in A549 cells, which correlated with enhanced tumor invasion and metastatic capabilities.
23539416 Altered expression of Hsc70 and eIF5A-1 may cause defects in nucleocytoplasmic transport and play a role in esophageal carcinogenesis.
23322277 Overexpression of EIF5A is associated with early-onset colorectal cancer.
23132580 acetylation regulates the subcellular localization of eIF5A2
22944692 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
22927971 eIF-5A as well as the hypusine-forming enzymes deoxyhypusine synthase (DHS) and deoxyhypusine hydroxylase (DOHH) are highly overexpressed in glioblastoma patient sample
22908221 a novel role for miR-331-3p and miR-642-5p in the control of prostate cancer cell growth via the regulation of DOHH expression and eIF5A activity.
22771473 identified PCAF as the major cellular acetyltransferase of eIF5A, and HDAC6 and SIRT2 as its major deacetylases. Inhibition of the deacetylases or impaired hypusination increased acetylation of eIF5A, leading to nuclear accumulation.
21778671 hybrid exercise increases expression of eukaryotic translation initiation factor 5A (EIFSA), peroxisomal biogenesis factor 6 (PEX6) and histone cluster 1 H4 (HIST1H4), compared with electrical stimulation alone
21360055 HIV-1 Rev cofactors Sam68, eIF5A, hRIP, and DDX3 also function in the translation of HIV-1 RNA.
21360055 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
21224998 EGF-induced upregulation of eIF5A stimulates corneal epithelial cell proliferation in vitro
20942800 loss of eIF5A activity by this SSAT1-mediated acetylation confirms the strict structural requirement for the hypusine side chain and suggests a possible regulation of eIF5A by hypusine acetylation/deacetylation
20830705 findings suggested that overexpression of eIF5A-2 correlates with local invasion of NSCLC, and might serve as an adverse prognostic marker of survival for stage I NSCLC patients
20232312 These observations collectively indicate that unhypusinated eIF5A1 plays a central role in the regulation of apoptosis.
19998337 High eIF5A expression is associated with hepatocellular carcinoma.
19825182 These data support the importance of eIF5A and hypusine formation in HIV-1 gene expression.
19379712 These findings provide strong evidence that the hypusine modification of eIF5A dictates its localization in the cytoplasmic compartment where it is required for protein synthesis.
19160416 Results suggest that the stability of eIF5A may have an important role in determining the fate of the particular cell type after severe heat stress.
19149558 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
18067580 Mutational analyses of human eIF5A-1--identification of amino acid residues critical for eIF5A activity and hypusine modification
17578650 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
17213197 analysis of the deoxyhypusine hydroxylase-eukaryotic translation initiation factor (eIF5A) interaction
17187778 These findings collectively indicate that unhypusinated eIF5A may have pro-apoptotic functions and that eIF5A is rapidly translocated to the nucleus following the induction of apoptotic cell death
17008552 analysis of differences in global protein expression in BCR-ABL-positive K562 cells treated with or without imatinib revealed down-regulation of eIF5A; hypusination inhibitors exerted an antiproliferative effect
16987817 data suggest that eIF5A mediates important cellular processes like cell viability and senescence through its effects on the stability of certain mRNAs
16842744 molecular model for the human eIF5A protein based on the crystal structure of the eIF5A from Leishmania brasiliensis
16522190 Recombinant human eIF-5A was crystallized by the hanging-drop vapor diffusion method
16519677 These findings suggest that the failure to detect eIF5A-2 protein even in eIF5A-2 mRNA positive cells is, at least in part, due to inefficient translation.
16515720 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
16354571 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
15371445 eIF5A may be a regulator of p53, and syntenin might regulate p53 by balancing the regulation of eIF5A signaling to p53 for apoptosis
12894223 EIF-5A expression inhibition by antisense oligodeoxynucleotides significantly enhanced the stimulating effect of GM-CSF on cell growth. Therefore, the eIF-5A accumulation played important roles in the apoptosis induced by UP inhibitors.
12687616 Patients having a higher eIF-5A protein expression showed a relatively poorer survival suggesting the use of eIF-5A as prognostic marker in lung adenocarcinoma.
12210765 Subcellular distribution of eIF-5A by indirect immunofluorescent staining and by direct visualization of green fluorescent protein tagged eIF-5A (GFP-eIF5A)
11870779 Heat stress-induced loss of eukaryotic initiation factor 5A (eIF-5A) in a human pancreatic cancer cell line
11238447 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
11161802 Eukaryotic initiation factor 5A (eIF5A) (eIF-4D, eIF-5A) stimulates ribosomal peptidyltransferase activity, transport of HIV-1-mRNAs and binds exportins 1 and 4. Contains hypusine at lys 50. Human EIF5A1 and EIF5A2 encode two isoforms: eIF5AI and eIF5AII.
10381392 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
9465063 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
9285100 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
9285095 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
8253832 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells
7971969 HIV-1 Nef downregulates the expression of eukaryotic translation initiation factor 5A (EIF5A) protein in Nef-transfected SupT1 cells

AA Sequence

MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYE      1 - 70
DICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSA     71 - 140
MTEEAAVAIKAMAK                                                            141 - 154
//

Text Mined References (87)

PMID Year Title
26773503 2016 Eukaryotic translation initiation factor 5A (eIF5A) is essential for HIF-1? activation in hypoxia.
26483550 2015 Eukaryotic Translation Initiation Factor 5A (EIF5A) Regulates Pancreatic Cancer Metastasis by Modulating RhoA and Rho-associated Kinase (ROCK) Protein Expression Levels.
25979826 2015 The translation factor eIF5A and human cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25261239 2014 A hypusine-eIF5A-PEAK1 switch regulates the pathogenesis of pancreatic cancer.
25218134 2014 The spermidine analogue GC7 (N1-guanyl-1,7-diamineoheptane) induces autophagy through a mechanism not involving the hypusination of eIF5A.
24491565 2014 Cadmium induces cytotoxicity in human bronchial epithelial cells through upregulation of eIF5A1 and NF-kappaB.
24402910 eIF5A and EF-P: two unique translation factors are now traveling the same road.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24220243 2014 Blocking eIF5A modification in cervical cancer cells alters the expression of cancer-related genes and suppresses cell proliferation.
23991020 2013 Gemcitabine eliminates double minute chromosomes from human ovarian cancer cells.
23733422 2013 Down-regulation of eIF5A-2 prevents epithelial-mesenchymal transition in non-small-cell lung cancer cells.
23539416 2013 Esophageal cancer alters the expression of nuclear pore complex binding protein Hsc70 and eIF5A-1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23322277 2013 Overexpression of CK20, MAP3K8 and EIF5A correlates with poor prognosis in early-onset colorectal cancer patients.
23132580 2012 The role of acetylation in the subcellular localization of an oncogenic isoform of translation factor eIF5A.
22927971 2012 Expression of eukaryotic initiation factor 5A and hypusine forming enzymes in glioblastoma patient samples: implications for new targeted therapies.
22908221 2012 Regulation of expression of deoxyhypusine hydroxylase (DOHH), the enzyme that catalyzes the activation of eIF5A, by miR-331-3p and miR-642-5p in prostate cancer cells.
22771473 2012 Acetylation regulates subcellular localization of eukaryotic translation initiation factor 5A (eIF5A).
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21778671 2011 "Hybrid exercise" prevents muscle atrophy in association with a distinct gene expression pattern.
21360055 2011 Translational regulation of HIV-1 replication by HIV-1 Rev cellular cofactors Sam68, eIF5A, hRIP, and DDX3.
21269460 2011 Initial characterization of the human central proteome.
21224998 2011 The role of eIF5A in epidermal growth factor-induced proliferation of corneal epithelial cell association with PI3-k/Akt activation.
20942800 2011 Inactivation of eukaryotic initiation factor 5A (eIF5A) by specific acetylation of its hypusine residue by spermidine/spermine acetyltransferase 1 (SSAT1).
20830705 2011 Overexpression of eIF5A-2 is an adverse prognostic marker of survival in stage I non-small cell lung cancer patients.
20232312 2010 Apoptosis induction by eIF5A1 involves activation of the intrinsic mitochondrial pathway.
19998337 2010 Prognostic significance and therapeutic potential of eukaryotic translation initiation factor 5A (eIF5A) in hepatocellular carcinoma.
19946888 2010 Defining the membrane proteome of NK cells.
19825182 2009 Inhibition of HIV-1 gene expression by Ciclopirox and Deferiprone, drugs that prevent hypusination of eukaryotic initiation factor 5A.
19379712 2009 The effect of hypusine modification on the intracellular localization of eIF5A.
19160416 2009 Thermal killing of human colon cancer cells is associated with the loss of eukaryotic initiation factor 5A.
18067580 2008 Mutational analyses of human eIF5A-1--identification of amino acid residues critical for eIF5A activity and hypusine modification.
17360499 2007 Neuronal growth and survival mediated by eIF5A, a polyamine-modified translation initiation factor.
17213197 2007 Specificity of the deoxyhypusine hydroxylase-eukaryotic translation initiation factor (eIF5A) interaction: identification of amino acid residues of the enzyme required for binding of its substrate, deoxyhypusine-containing eIF5A.
17187778 2007 Eukaryotic translation initiation factor 5A induces apoptosis in colon cancer cells and associates with the nucleus in response to tumour necrosis factor alpha signalling.
17008552 2007 Hypusination of eukaryotic initiation factor 5A (eIF5A): a novel therapeutic target in BCR-ABL-positive leukemias identified by a proteomics approach.
16987817 2006 Temperature-sensitive eIF5A mutant accumulates transcripts targeted to the nonsense-mediated decay pathway.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16842744 2006 Molecular modeling of the human eukaryotic translation initiation factor 5A (eIF5A) based on spectroscopic and computational analyses.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16522190 2005 Crystallization and preliminary crystallographic analysis of human eukaryotic translation initiation factor 5A (eIF-5A).
16519677 2006 Differential expression of eIF5A-1 and eIF5A-2 in human cancer cells.
16452303 2006 The post-translational synthesis of a polyamine-derived amino acid, hypusine, in the eukaryotic translation initiation factor 5A (eIF5A).
16371467 2006 Molecular cloning, expression, and structural prediction of deoxyhypusine hydroxylase: a HEAT-repeat-containing metalloenzyme.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452064 2004 Role of eIF5A in TNF-alpha-mediated apoptosis of lamina cribrosa cells.
15371445 2004 A novel eIF5A complex functions as a regulator of p53 and p53-dependent apoptosis.
15303967 2004 Identification of mRNA that binds to eukaryotic initiation factor 5A by affinity co-purification and differential display.
15262146 2004 Eukaryotic initiation factor 5A-1 (eIF5A-1) as a diagnostic marker for aberrant proliferation in intraepithelial neoplasia of the vulva.
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14622290 2003 Identification and characterization of eukaryotic initiation factor 5A-2.
12894223 2003 Proteomic analysis of ubiquitin-proteasome effects: insight into the function of eukaryotic initiation factor 5A.
12788913 2003 Reversal of the deoxyhypusine synthesis reaction. Generation of spermidine or homospermidine from deoxyhypusine by deoxyhypusine synthase.
12687616 2003 Proteomic analysis of eIF-5A in lung adenocarcinomas.
12562768 2003 Molecular evolution by change of function. Alkaloid-specific homospermidine synthase retained all properties of deoxyhypusine synthase except binding the eIF5A precursor protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12210765 2002 Subcellular localization of the hypusine-containing eukaryotic initiation factor 5A by immunofluorescent staining and green fluorescent protein tagging.
11870779 2002 Heat stress-induced loss of eukaryotic initiation factor 5A (eIF-5A) in a human pancreatic cancer cell line, MIA PaCa-2, analyzed by two-dimensional gel electrophoresis.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11742107 2001 Homology modelling of the human eukaryotic initiation factor 5A (eIF-5A).
11238447 2001 Cofactor requirements for nuclear export of Rev response element (RRE)- and constitutive transport element (CTE)-containing retroviral RNAs. An unexpected role for actin.
11161802 2001 Human eIF5A2 on chromosome 3q25-q27 is a phylogenetically conserved vertebrate variant of eukaryotic translation initiation factor 5A with tissue-specific expression.
10944119 2000 Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes.
10381392 1999 Nuclear pore localization and nucleocytoplasmic transport of eIF-5A: evidence for direct interaction with the export receptor CRM1.
10229683 1999 Complex formation between deoxyhypusine synthase and its protein substrate, the eukaryotic translation initiation factor 5A (eIF5A) precursor.
9465063 1998 Interaction of the HIV-1 rev cofactor eukaryotic initiation factor 5A with ribosomal protein L5.
9442029 1998 Identification of the eukaryotic initiation factor 5A as a retinoic acid-stimulated cellular binding partner for tissue transglutaminase II.
9285100 Interaction of eukaryotic initiation factor 5A with the human immunodeficiency virus type 1 Rev response element RNA and U6 snRNA requires deoxyhypusine or hypusine modification.
9285095 Eukaryotic initiation factor 5A activity and HIV-1 Rev function.
8660923 1996 The subcellular distribution of eukaryotic translation initiation factor, eIF-5A, in cultured cells.
8596953 1996 Inhibition of HIV-1 replication in lymphocytes by mutants of the Rev cofactor eIF-5A.
8253832 1993 Eukaryotic initiation factor 5A is a cellular target of the human immunodeficiency virus type 1 Rev activation domain mediating trans-activation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7971969 1994 Induced gene expression of the hypusine-containing protein eukaryotic initiation factor 5A in activated human T lymphocytes.
7929297 1994 Structural features of the eIF-5A precursor required for posttranslational synthesis of deoxyhypusine.
7759117 1995 The eukaryotic cofactor for the human immunodeficiency virus type 1 (HIV-1) rev protein, eIF-5A, maps to chromosome 17p12-p13: three eIF-5A pseudogenes map to 10q23.3, 17q25, and 19q13.2.
7622067 1995 Identification of a new member of the human eIF-5A gene family.
7578077 1995 Isolation and structural characterization of different isoforms of the hypusine-containing protein eIF-5A from HeLa cells.
7545941 1994 The genomic structure encoding human initiation factor eIF-5A.
3095320 1986 Eukaryotic initiation factor 4D. Purification from human red blood cells and the sequence of amino acids around its single hypusine residue.
2492279 1989 Sequence determination and cDNA cloning of eukaryotic initiation factor 4D, the hypusine-containing protein.
1900436 1991 Eukaryotic initiation factor 5A: the molecular form of the hypusine-containing protein from human erythrocytes.
1850732 1991 Comparison of the activities of variant forms of eIF-4D. The requirement for hypusine or deoxyhypusine.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.