Property Summary

NCBI Gene PubMed Count 31
PubMed Score 79.32
PubTator Score 33.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis 1.700 8.9e-04
osteosarcoma -2.437 9.8e-08
glioblastoma -1.500 1.2e-05
atypical teratoid / rhabdoid tumor -1.800 1.6e-09
medulloblastoma, large-cell -1.300 1.3e-04
hereditary spastic paraplegia -1.217 8.2e-03
tuberculosis and treatment for 6 months 1.100 5.9e-05
pancreatic ductal adenocarcinoma liver m... -1.941 1.2e-03
non-small cell lung cancer -1.309 1.2e-17
lung cancer -3.400 4.6e-06
colon cancer -1.200 3.0e-02
pediatric high grade glioma -1.200 4.5e-06
pilocytic astrocytoma -1.100 4.4e-07
lung adenocarcinoma -1.300 3.4e-10
Pick disease -1.200 1.3e-05
Breast cancer -1.900 2.5e-29
ovarian cancer 2.100 3.3e-05
dermatomyositis 1.300 2.4e-03

Gene RIF (9)

PMID Text
26717981 it is eIF5-induced GTP hydrolysis and Pi release that irreversibly trap the 48S complex, and this complex is further stabilized by eIF5B and 60S joining.
25631074 Cellular biotinylated eukaryotic translation initiation factor 5 (EIF5) protein is incorporated into HIV-1 Gag virus-like particles
24319994 The N-terminal tail of eIF1A mediates the interaction with eIF5 and eIF1.
23293029 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex
22813744 This study provides mechanistic insight into the role of eIF5-carboxyl terminal domain's dynamic interplay with eIF1 and eIF2beta.
22062548 miR-5787 represses cell growth, in part, by targeting eIF5.
16781736 The carboxy-terminal domain (CTD)of eIF5 is exclusively composed out of alpha-helices and is homologous to the carboxy-terminal domain of eIF2B-epsilon (eIF2Bepsilon-CTD). The binding sites of eIF2-beta, eIF3 and eIF1 were mapped onto the structure.
16584190 3-dimensional solution structure of N-terminal domain of human eIF5, has 2 subdomains, both reminiscent of nucleic-acid-binding modules. N-terminal subdomain contains "arginine finger" motif essential for GAP function.
16227438 CK2 may be involved in the regulation of cell cycle progression by associating with and phosphorylating a key molecule for translation initiation.

AA Sequence

MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVK      1 - 70
NDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTF     71 - 140
ILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSETPPPPPPPNEINPPPHTMEEEEDDDWGEDTTEE    141 - 210
AQRRRMDEISDHAKVLTLSDDLERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVL    211 - 280
TEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEV    281 - 350
IISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAASVPKVETVKSD    351 - 420
NKDDDIDIDAI                                                               421 - 431
//

Text Mined References (42)

PMID Year Title
26717981 2016 Sliding of a 43S ribosomal complex from the recognized AUG codon triggered by a delay in eIF2-bound GTP hydrolysis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24658146 2014 Subcellular fractionation and localization studies reveal a direct interaction of the fragile X mental retardation protein (FMRP) with nucleolin.
24319994 2013 The interaction between eukaryotic initiation factor 1A and eIF5 retains eIF1 within scanning preinitiation complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23293029 2013 Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22813744 2012 The C-terminal domain of eukaryotic initiation factor 5 promotes start codon recognition by its dynamic interplay with eIF1 and eIF2?.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22156057 2012 Stringency of start codon selection modulates autoregulation of translation initiation factor eIF5.
22062548 2011 The hsa-miR-5787 represses cellular growth by targeting eukaryotic translation initiation factor 5 (eIF5) in fibroblasts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16781736 2006 The crystal structure of the carboxy-terminal domain of human translation initiation factor eIF5.
16584190 2006 Structure of the eukaryotic initiation factor (eIF) 5 reveals a fold common to several translation factors.
16227438 2005 CK2 phosphorylation of eukaryotic translation initiation factor 5 potentiates cell cycle progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12569173 2003 Mapping the binding interface between human eukaryotic initiation factors 1A and 5B: a new interaction between old partners.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426392 2002 Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm.
11861906 2002 Phosphorylation of mammalian translation initiation factor 5 (eIF5) in vitro and in vivo.
11331597 2001 Multiple roles for the C-terminal domain of eIF5 in translation initiation complex assembly and GTPase activation.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11092890 2001 Eukaryotic translation initiation factor 5 functions as a GTPase-activating protein.
10982835 2000 Physical and functional interaction between the eukaryotic orthologs of prokaryotic translation initiation factors IF1 and IF2.
10805737 2000 Mutational analysis of mammalian translation initiation factor 5 (eIF5): role of interaction between the beta subunit of eIF2 and eIF5 in eIF5 function in vitro and in vivo.
9973622 1999 Cloning and characterization of the p42 subunit of mammalian translation initiation factor 3 (eIF3): demonstration that eIF3 interacts with eIF5 in mammalian cells.
9395514 1997 Specific interaction of eukaryotic translation initiation factor 5 (eIF5) with the beta-subunit of eIF2.
8663286 1996 Characterization of multiple mRNAs that encode mammalian translation initiation factor 5 (eIF-5).