Property Summary

NCBI Gene PubMed Count 52
PubMed Score 321.96
PubTator Score 28.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.600 8.7e-05
osteosarcoma 1.166 1.7e-04
primary pancreatic ductal adenocarcinoma 1.030 4.1e-03
diabetes mellitus 1.200 1.8e-03
acute myeloid leukemia 1.600 8.4e-03
ovarian cancer -1.400 1.6e-05
pancreatic cancer 1.100 1.1e-02

Protein-protein Interaction (3)

Gene RIF (23)

PMID Text
26165837 Knockdown of EIF4G2 recapitulated the effects of mir-139, whereas restoring EIF4G2 expression rescued the mir-139 phenotype. elevated miR-139-5p expression is associated with a favorable outcome in acute myeloid leukemia.
25779044 findings provide the first mechanistic insights into the function of DAP5 as a selective regulator of cap-independent translation
24497838 Our results provide evidence that the tumor suppressor effect of miR-520c-3p is mediated through repression of translation while inducing senescence and that eIF4GII is a key effector of this anti-tumor activity.
23318444 DAP5, a translation initiation factor shown to positively regulate the translation of various internal ribosome entry sites containing mRNAs, promotes internal ribosome entry site-driven translation of p53 mRNA.
22909319 Multiple isoforms of eIF4GII arise from multiple promoters & alternative splicing events. A non-canonical CUG initiation codon extends the eIF4GII N-terminus. The eIF4GII N-terminus plays an alternative role in initiation factor assembly.
22555068 DAP5/p97 and DAP5/p86 enhanced the translation of the anti-apoptotic protein Bcl-2 and inhibited cisplatin-induced apoptosis
20544972 crystal structure of C-terminal region (residues 540-897) of p97/EIF4G2 (at 2.0 Angstrom resolution): sequence/structure homology with EIF4G1
20057060 crystallization and preliminary X-ray diffraction analysis of the MIF4G domain of DAP5 is presented.
19769989 eIF4GI does not colocalize with ribosomes in VSV-infected cells, while eIF2alpha locates at perinuclear sites coincident with ribosomes.
18722383 Results report the crystal structure of the C-terminal region of DAP5/p97 extending between amino acids 730 and 897.
18491231 role and regulation of death-associated protein-5 (DAP5/p97/NAT1), a novel inhibitor of translational initiation, in acute promyelocytic leukemia cell differentiation and apoptosis
18450493 Data show that DAP5 promotes cap-independent translation of Bcl-2 and CDK1 to facilitate cell survival during mitosis.
17237356 These data indicate that full-length p97 is a translational activator with essential role(s) in unstressed cells, suggesting a reassessment of current models of p97 function.
17195095 Data show that coxsackievirus B3 proteases 2A and 3C induce apoptotic cell death through mitochondrial injury and cleavage of eIF4GI but not DAP5.
16932749 p97 is functionally different from the closely related C-terminal two-thirds of eIF4GI and it can positively promote protein synthesis and cell proliferation.
16410684 EIF4G2 transcripts exhibited three different expression patterns, downregulation was found in about 50% of the cases analyzed and EIF4G2 gene transcription was associated with invasive tumors.
15718103 Exclusive use of a GUG translation initiation codon is conserved in human, chicken, Xenopus, and zebrafish.
15016848 Cleavage of eIF4GII is induced in cells and in cell extracts by the FMDV leader protease (L(pro)) alone
14507913 endogenous eIF4GII was phosphorylated by Ca(2+)/calmodulin-dependent protein kinase I
12505164 proteolytic activity of HIV-1 protease on eIF4GI and eIF4GII and its implications for the translation of mRNAs
11943866 The caspase-cleaved DAP5 protein supports internal ribosome entry site-mediated translation of death proteins
11331597 Includes the functional analysis of a similar protein in yeast.
9049310 translation starts exclusively at a non-AUG translation initiation codon (GUG).

AA Sequence

MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDDNSAANNSANE      1 - 70
KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLA     71 - 140
EDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGN    141 - 210
IKFIGELGKLDLIHESILHKCIKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFAR    211 - 280
MCSLMLSKELPARIRFLLQDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDF    281 - 350
FLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS    351 - 420
QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL    421 - 490
QPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPSKEELLKLTETVVTEYLNSGN    491 - 560
ANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCP    561 - 630
KLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVN    631 - 700
MQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVN    701 - 770
ILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN    771 - 840
SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD       841 - 907
//

Text Mined References (69)

PMID Year Title
26165837 2016 miR-139-5p controls translation in myeloid leukemia through EIF4G2.
25779044 2015 DAP5 associates with eIF2? and eIF4AI to promote Internal Ribosome Entry Site driven translation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24497838 2014 Down-regulation of eIF4GII by miR-520c-3p represses diffuse large B cell lymphoma development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23318444 2014 The translation initiation factor DAP5 promotes IRES-driven translation of p53 mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909319 2012 Multiple isoforms of the translation initiation factor eIF4GII are generated via use of alternative promoters, splice sites and a non-canonical initiation codon.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22555068 2012 DAP5 ameliorates cisplatin-induced apoptosis of renal tubular cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20544972 2010 Crystal structure of the C-terminal region of human p97/DAP5.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20057060 2010 Crystallization and preliminary X-ray diffraction analysis of the MIF4G domain of DAP5.
19946888 2010 Defining the membrane proteome of NK cells.
19769989 2009 Translation of mRNAs from vesicular stomatitis virus and vaccinia virus is differentially blocked in cells with depletion of eIF4GI and/or eIF4GII.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18722383 2008 The crystal structure of the C-terminal DAP5/p97 domain sheds light on the molecular basis for its processing by caspase cleavage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18491231 2008 Death-associated protein 5 (DAP5/p97/NAT1) contributes to retinoic acid-induced granulocytic differentiation and arsenic trioxide-induced apoptosis in acute promyelocytic leukemia.
18450493 2008 DAP5 promotes cap-independent translation of Bcl-2 and CDK1 to facilitate cell survival during mitosis.
18426977 2008 eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy.
18088087 2008 Phosphoproteome of resting human platelets.
18025107 2008 SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17237356 2007 The eIF4G-homolog p97 can activate translation independent of caspase cleavage.
17195095 2007 Coxsackievirus B3 proteases 2A and 3C induce apoptotic cell death through mitochondrial injury and cleavage of eIF4GI but not DAP5/p97/NAT1.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16932749 2006 p97/DAP5 is a ribosome-associated factor that facilitates protein synthesis and cell proliferation by modulating the synthesis of cell cycle proteins.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16410684 2005 The transcripts of SFRP1,CEP63 and EIF4G2 genes are frequently downregulated in transitional cell carcinomas of the bladder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289705 2006 An efficient mammalian cell-free translation system supplemented with translation factors.
16166382 2005 Structural basis for the enhancement of eIF4A helicase activity by eIF4G.
15718103 2005 Evolutionarily conserved non-AUG translation initiation in NAT1/p97/DAP5 (EIF4G2).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361857 2004 eIF4G is required for the pioneer round of translation in mammalian cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15016848 2004 Cleavage of eukaryotic translation initiation factor 4GII within foot-and-mouth disease virus-infected cells: identification of the L-protease cleavage site in vitro.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14507913 2003 Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I.
12703993 2003 [Effect of beta-carotene on gene expression of breast cancer cells].
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12505164 2003 Cleavage of eIF4G by HIV-1 protease: effects on translation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943866 2002 The caspase-cleaved DAP5 protein supports internal ribosome entry site-mediated translation of death proteins.
11511540 2001 Suppression of cap-dependent translation in mitosis.
11331597 2001 Multiple roles for the C-terminal domain of eIF5 in translation initiation complex assembly and GTPase activation.
11175261 2000 Cleavage of eukaryotic translation initiation factor 4GII correlates with translation inhibition during apoptosis.
11172724 2001 A conserved HEAT domain within eIF4G directs assembly of the translation initiation machinery.
10611228 2000 A novel form of DAP5 protein accumulates in apoptotic cells as a result of caspase cleavage and internal ribosome entry site-mediated translation.
10394359 1999 Cap-dependent translation initiation in eukaryotes is regulated by a molecular mimic of eIF4G.
9878069 1999 Human eukaryotic translation initiation factor 4G (eIF4G) recruits mnk1 to phosphorylate eIF4E.
9372926 1997 Human eukaryotic translation initiation factor 4G (eIF4G) possesses two separate and independent binding sites for eIF4A.
9049310 1997 A new translational regulator with homology to eukaryotic translation initiation factor 4G.
9032289 1997 DAP-5, a novel homolog of eukaryotic translation initiation factor 4G isolated as a putative modulator of gamma interferon-induced programmed cell death.
9030685 1997 A novel translational repressor mRNA is edited extensively in livers containing tumors caused by the transgene expression of the apoB mRNA-editing enzyme.
9027506 1997 cDNA cloning, expression analysis, and chromosomal localization of a gene with high homology to wheat eIF-(iso)4F and mammalian eIF-4G.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.