Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.71
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP      1 - 70
PTAPLSKLEELKEQETEEEIPDDAQFEMDI                                             71 - 100
//

Text Mined References (16)

PMID Year Title