Property Summary

NCBI Gene PubMed Count 182
PubMed Score 534.74
PubTator Score 371.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Protein-protein Interaction (8)

Gene RIF (131)

PMID Text
26832959 It was concluded that over-activation of the mTORC1/4E-BP1/p21 pathway is a frequent and clinically relevant alteration in head and neck squamous cell carcinomas.
26577921 Increased 4EBP1 abundance was a common feature in prostate cancer patients who had been treated with the PI3K pathway inhibitor BKM120; thus, 4EBP1 may be associated with drug resistance in human tumors
26427479 Results suggest that blocking both the mTOR kinase downstream targets 4E-BP1 protein and p70 S6 kinase 1, but not p70 S6 kinase 1 alone, prevents the migration of retinal pigment epithelium (RPE) cells.
26360779 Twist1 is correlated with p-4E-BP1 in predicting the prognostic outcome of NSCLC.
26305094 results suggest that respiratory syncytial virus is a virus that still contains unknown mechanisms involved in the translation of their mRNAs through the alteration or modification of some translation factors, such as 4EBP1, possibly to favor its replicative
26204490 eIF4E binding protein 1 expression has a role in clinical survival outcomes in colorectal cancer
26170285 the C-terminal extension (motif 3) is critical to 4E-BP1-mediated cell cycle arrest and it partially overlaps with the binding site of 4EGI-1
26097581 phosphorylation site affected the prognostic significance of 4EBP1 in non-small cell lung cancer.
25999352 Taken together, these results highlight the potential dependence of eIF4G overexpression and 4E-BP1 phosphorylation in CLL survival.
25883264 mitotic cap-dependent translation is generally sustained during mitosis by CDK1 phosphorylation of 4E-BP1 even under conditions of reduced mTOR signaling
25762619 mTORC1 regulates cell adhesion through S6K1 and 4E-BP1 pathways, but mTORC2 regulates cell adhesion via Akt-independent mechanism
25755728 In colorectal carcinoma, total expression levels of 4E-BP1 increased only in the premalignant state of the disease and decreased (but highly phosphorylated or inactivated) or abolished upon malignancy.
25702871 Molecular structure of EIF4E bound to 4E-BP1 provides insight into the consequences of phosphorylation.Phosphorylation of 4E-BP1 impairs the competition with eIF4G for eIF4E binding.
25659153 Tanshinone IIA inhibits HIF-1alpha and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25618298 inactivation of 4E-BP1 using Ku-0063794 may be a promising novel approach for muscle-invasive bladder cancer
25503819 Effect of temperature on the conformation of natively unfolded protein 4E-BP1 in aqueous and mixed solutions containing trifluoroethanol and hexafluoroisopropanol.
25482447 4E-BP1 is a trigger for parthenolide -induced autophagy
25466966 certain Akt/mTOR/4E-BP1 pathway signals could be novel therapeutic targets for Merkel cell carcinomas regardless of Merkel cell polyomavirus infection status
25439783 4E-BP1/eIF4E ratio may represent a therapeutic index for the prediction of clinical outcome of rapamycin treatment in patients with esophageal squamous cell carcinoma.
25431930 4EBP1 is not completely unstructured, but contains a pre-structured helix.
25165983 Results show that high expression of p70S6K and 4EBP1 proteins may act as valuable independent biomarkers to predict poor prognosis of nasopharyngeal carcinoma patients.
25114899 Studied conditions that increase the sensitivity of cancer cells to MK-2206. and found reduction by salinomycin of Akt and downregulation of pAkt, pGSk3beta, pTSC2, and p4EBP1 by cotreatment with MK-2206.
24837366 ShcA drives breast tumor growth and angiogenesis in vivo in a 4E-BP-dependent manner
24780446 Data show that salvianolic acid B protects endothelial progenitor cells against oxidative stress by modulating Akt/mTOR/4EBP1, p38 MAPK/ATF2, and ERK1/2 signaling pathways.
24706262 Overexpression of phosphorylated 4E-binding protein 1 is associated with lymph node metastasis in hilar cholangiocarcinoma
24515783 Results show that loss-of-function of TBC1D7 protein was associated with an increase in the phosphorylation of 4EBP1, a direct downstream target of mTORC1.
24466059 The tumor marker eRF3B can change the cell cycle and influence the phosphorylation status of 4E-BP1.
24401275 rapalog-activated MNK1 signaling promotes glioma growth through regulation of 4EBP1; there is a molecular cross-talk between the mTORC1 and MNK1 pathways
24354477 Acquired drug resistance to antineoplastic agents is regulated in part by 4E-BP1.
24307346 p-4E-BP1 may have a role in response to the mTOR inhibitors and progression-free survival
24211447 The 4E-BP1 binding stabilizes the active eIF4E conformation and, on the other hand, can facilitate dissociation of eIF4E from the mRNA cap.
24206664 mTORC1 controls mitochondrial activity and biogenesis by selectively promoting translation of nucleus-encoded mitochondria-related mRNAs via inhibition of the eukaryotic translation initiation factor 4E (eIF4E)-binding proteins (4E-BPs).
24131622 The mTOR effectors 4EBP1 and S6K2 are frequently coexpressed, and associated with a poor prognosis and endocrine resistance in breast cancer.
24122746 The aim of the present work was to probe the conformation of the intrinsically disordered protein 4E-BP1 in the native and partly folded states by limited proteolysis and to reveal regions with a high propensity to form an ordered structure.
24030155 overexpression of 4EBP1, p70S6K, Akt1 or Akt2 could promote the Coxsackievirus B3-induced apoptosis.
23814053 study has identified protein phosphatase PPM1G as a novel regulator of cap-dependent protein translation by negatively controlling the phosphorylation of 4E-BP1.
23707523 The results indicate mTOR-independent phosphorylation of S6K1 and 4E-BP1 and suggest MEK/ERK/RSK1-dependent phosphorylation of eIF4B during skeletal muscle contraction.
23640516 Our results suggest that long-term repeated viral delivery of 4E-BP1 may provide a useful tool for designing lung cancer treatment.
23547259 4E-BP1 antagonizes stress granules formation when it is hypophosphorylated.
23451476 The high expression of mTOR and 4EBP1 is closely related with clinicopathology and lymph node metastases in laryngeal carcinoma.
23340172 phosphorylation of 4E-BP1 may be a predictive biomarker of everolimus sensitivity in gastric cancer
23175522 Data therefore suggest that HIF-1alpha contributes to 4E-BP1 gene expression under different conditions.
23100465 The eIF4E/4E-BP ratio, rather than their individual protein levels or solely their phosphorylation status, should be considered as a paramount predictive marker for forecasting the clinical therapeutic response to mTOR inhibitors.
23082216 A potential interaction of LRRK2 and 4E-BP1 in mammalian cells and brain, is investigated.
22977662 The nuclear expression of p-mTOR, p-4E-BP1 and p-p70S6K was associated with biological behaviors (invasiveness) of ameloblastomas, and p-mTOR was an independent predictor of them.
22918237 4E-BP1, beyond its role in translation regulation, can function as a regulator of mitosis via interacting with PLK1, and possibly plays a role in genomic stability maintaining.
22690797 the presence of p-4E-BP1 predicted shortened overall survival in the entire cohort and glioblastomas.
22652449 The nsPEF exposure caused a rapid decrease in 4E-BP1 phosphorylation irrespective of the PERK/GCN2 status, suggesting participation of both eIF2alpha and 4E-BP1 in nsPEF-induced translational suppression.
22457629 HIV-1 Vpr expression in HEK293 cells is sufficient to decrease the levels of phosphorylated eIF4E and 4E-BP1
22248270 High 4EBP1 phosphorylation is associated with intrahepatic cholangiocarcinoma.
22216185 mTORc1 inhibition reduces eIF4F complex formation, and depresses translocation of TOP mRNAs on polysomes. Downregulation of eIF4E and overexpression of 4E-BP1 induce rapamycin sensitivity
22184107 Hepatitis C virus NS5A binds to the mRNA cap-binding eukaryotic translation initiation 4F (eIF4F) complex and up-regulates host translation initiation machinery through eIF4E-binding protein 1 inactivation.
22178476 Binding of 4EBP1 or eIF4G allosterically drove alterations throughout the protein that increase the affinity of eIF4E for the 5'cap.
22142830 Studies indicate that mTOR phosphorylation of the 4E-BPs (4E-BP1 is the major epithelial cell form) promotes cap-dependent mRNA translation.
22110663 S6K1 and 4E-BP1 are independent regulated and control cellular growth in bladder cancer
21964297 This clearly indicates the importance of the second binding region for the difference in function between eIF4G and 4E-BP for eIF4E
21922152 LRRK2 down-regulation was associated with a clearly decreased 4E-BP1 protein in a breast cancer cell line
21914810 dissociation of PRAS40 from insulin-stimulated 4E-BP protein binding to mTORC1 and enhanced mTORC1 substrate binding results from Akt and mTORC1 activation and makes little or no contribution to mTORC1 signaling
21913890 It is concluded that the conserved PGVTS/T motif within the flexible C-terminus of 4E-BP plays an auxiliary, but indispensable, role in strengthening the binding of eIF4E to the core Y(X)4LPhi motif.
21841310 Data show that 4E-BP1 inhibition by Merkel cell polyomavirus small T antigen is required for Merkel cell polyomavirus neoplastic cell transformation.
21784851 when lung fibroblasts are attached to collagen matrix, the beta1 integrin/Src/PP2A-mediated 4EBP-1 regulatory pathway is activated
21750861 We propose that high p-4E-BP1 and p-eIF4E levels are central factors in cell signaling and reflect the oncogenic potential of cell signaling pathways in breast cancer.
21661078 Data show that the eIF4E binding preference for 4E-BP2 over 4E-BP1 is based on stacking of Arg63 side chain on Trp73 indole ring of eIF4E and construction of hydrophobic space around the Trp73 indole ring by the Leu59-Leu60 sequence of 4E-BP2.
21576371 Data suggest that knockdown of raptor relieves autophagy and the eIF4E effector pathway from rapamycin resistance.
21366462 The immunohistochemical expression pattern of 4E-BP1 exhibits regional and cellular specificity in reactive lymphoid tissues.
21067588 Data show that the mTOR effectors, 4EBP1, p70S6K and rpS6, are highly activated in cultured and primary FLT3-mutated acute myeloid leukemia (AML) cells.
21046149 assessment of phosphorylated-4E-BP1 expression could identify a subpopulation of earlier stage esophageal squamous cell carcinoma patients with poor prognosis.
20621385 potential prognostic factor for survival in patients with lung adenocarcinoma
20609351 High 4E-BP1 is a key effector of the oncogenic activation of the AKT and ERK signaling pathways that integrates their results in tumors.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20372058 Data show that 4E-BP1 gene transcription increases in a cell density-dependent manner, and that 4E-BP1 protein accumulation is involved in cell cycle arrest at contact inhibition likely through downregulation of cyclin D1 expression.
20304964 p22(phox)-based Nox oxidases maintain HIF-2alpha protein expression through inactivation of tuberin and downstream activation of ribosomal protein S6 kinase 1/4E-BP1 pathway
20133758 Data suggest that pUL69 supports translation in human cytomegalovirus-infected cells by excluding hypophosphorylated 4EBP1 from the cap-binding complex.
20090955 results suggest that 4E-BP is a relatively poor direct substrate for LRRK2
19850923 RhoE inhibits 4E-BP1 phosphorylation and eIF4E function impairing cap-dependent translation.
19834456 4E-BP1 gene appears critical for TGFbeta/Smad4-mediated inhibition of cell proliferation.
19648884 Report EGFR-dependent and independent activation of Akt/mTOR/p70S6 kinase/4E-BP1 cascade in bone and soft tissue tumors.
19603014 Activated 4E-BP1 represses tumourigenesis and IGF-I-mediated activation of the eIF4F complex in mesothelioma.
19574449 High-density lipoproteins can protect beta-cells through modulation of 4E-BP1 depending on the type of stress stimuli.
19541645 In metastatic brain lesions carrying activated alpha(v)beta(3), VEGF expression is controlled at the post-transcriptional level and involves phosphorylation and inhibition of translational respressor 4E-binding protein (4E-BP1).
19533653 This study demenostrated that the 4E-BP1 is reduced in skeletal muscle of chronic spinal cord-injured patients.
19429661 Our results suggest that up-regulation of AKT1 and 4EBP1 in eutopic endometrium may be associated with the pathogenesis of endometriosis.
19428047 expression of phospho-4E-BP1 and HER2 overexpression were the only characteristics with prognostic significance in endometrial carcinoma
19367274 Expression levels of eIF4E, 4E-BP1 and 4E-BP2 in breast cancer predict patient survival.
19360336 Combination of Adenovirus- 4E-BP1 and rapamycin may be a more effective adjuvant therapy.
19336517 This study reveals that p-4E-BP1 is significantly associated with worse melanoma survival.
19271249 Observational study of gene-disease association. (HuGE Navigator)
19244480 4E-BPs regulate the stress granule localization of eIF4E
19211763 PI3K signaling, therefore, plays a critical role in regulating protein production during VV infection, at least in part by controlling the abundance and activity of 4E-BP1.
19107520 Expression of mTOR and 4EBP1 characterize high-grade, high-stage endometrial adenocarcinomas and might be predictive markers of a response to rapamycin.
19036825 Skeletal muscle eEF2 and 4EBP1 phosphorylation during endurance exercise is dependent on intensity and muscle fiber type.
18810319 These data show that, in addition to inactivation of 4E-BP1 via hyperphosphorylation, signaling through the PI3K pathway silences 4E-BP1 gene transcription.
18708753 Effects of 4E-BP1 expression on hypoxic cell cycle inhibition and tumor cell proliferation and survival are reported.
18701920 chronic inactivation of 4E-BP by LRRK2 with pathogenic mutations deregulates protein translation, eventually resulting in age-dependent loss of DA neurons
18668138 endocrine hormone insulin contributes to VEGF release in skin wounds through an Akt1-and 4E-BP1- mediated posttranscriptional mechanism in keratinocytes
18660489 Observational study of gene-disease association. (HuGE Navigator)
18442140 This study revealed genetic associations of SLC1A4, SQSTM1, and EIF4EBP1 with MSA. These results may lend genetic support to the hypothesis that oxidative stress is associated with the pathogenesis of MSA.
18442140 Observational study of gene-disease association. (HuGE Navigator)
18439897 SF2/ASF promotes translation initiation of bound mRNAs; this activity requires the presence of the cytoplasmic cap-binding protein eIF4E.
18384376 Analysis of the regulatory motifs in EIF4EBP1 was performed.
18337562 CCL5 induced PI-3'K-, phospholipase D-, and mTOR-dependent phosphorylation and deactivation of the transcriptional repressor 4E-BP1, which resulted in its dissociation from eIF4E
18280804 treatment of acute promyelocytic leukemia (APL)-derived NB4 cells with all-trans-retinoic acid results in dissociation of the translational repressor 4E-BP1 from the eukaryotic initiation factor eIF4E, and subsequent formation of eIF4G-eIF4E complexes.
18051367 HIV-1 Vpr expression in HEK293 cells is sufficient to decrease the levels of phosphorylated eIF4E and 4E-BP1
17724476 Key regulator of cyclin D1 expression.
17699757 Phosphorylated 4E-BP1 (p-4E-BP1) expression in tumors is associated with malignant progression and an adverse prognosis regardless of the upstream oncogenic alterations.
17653084 The phosphorylation of 4E-BP1 may play a dual role in the regulation of protein synthesis, both reducing the affinity of 4E-BP1 for eIF4E and promoting the conversion of 4E-BP1 to alternative, polyubiquitinated forms.
17604271 PRAS40 acts downstream of mTORC1 but upstream of its effectors, such as S6K1 and 4E-BP1
17601486 These results demonstrate that "pure" isoprenoids and genistein differentially impact cap-dependent translation in tumor cell lines.
17200342 4E-binding protein 1 has a role in progression of breast neoplasms through cell signaling
17114181 mTOR-dependent pathways have roles in IFN signaling and 4E-BP1 and TSC1-TSC2 are key components in the generation of IFN-dependent biological responses
16983702 In patients with ovarian carcinoma, significant expression of p-4EBP1 was associated with high-grade tumors and a poor prognosis, regardless other oncogenic alterations upstream.
16873412 AMPK activation and a reduced phosphorylation of 4E-BP1 may contribute to the inhibition of muscle protein synthesis during resistance exercise.
16824195 4E-BP1, that binds to eukaryotic initiation factor-4E to prevent the formation of the active translation complex, dissociates from eIF4E by phosphorylation through the mammalian target of rapamycin (mTOR) in cells stimulated by amino acids.
16715128 both ribosomal protein S6 kinase, 70kDa and 4E-BP1 pathways, regulated by TORC1, are required for cell motility
16652388 eukaryotic translation initiation factor 4E binding protein 1(4E-BP1) overexpression is associated with prostate cancer, especially when combined with phosphatase and tensin homolog(PTEN) and mammalian target of rapamycin(mTOR) expression data
16648488 Hypoxia inhibits protein synthesis through a 4EBP1 and EEF2 pathway controlled by mTOR and uncoupled in breast cancer cells.
16098202 levels of p-mTOR (Ser2481), and p-4E-BP1 (Thr70 and Ser65) dramatically increase in Alzheimer disease, and are positively significantly correlated with total tau and p-tau
15542544 These findings suggest that hyperoxia diminishes protein synthesis by increasing eIF4E phosphorylation and enhancing the affinity of 4E-BP1 for eIF4E.
15178440 role as physiological substrates for the protein kinase activity of PI 3-kinase and suggests this activity operates in a physiological context by phosphorylating substrates other than the PI 3-kinase itself
15094042 4EHP over-expression instigates a negative feedback loop that inhibits upstream signaling to 4E-BP1 and ribosomal protein S6 kinase 1 (S6K1) whereas the 4E-BP1-binding-deficient mutant of 4EHP(W95A) was unable to trigger this feedback loop
14507920 Ser-64 and Ser-111 are not required for the control of PHAS-I binding to eIF4E in cells, implicating phosphorylation of the Thr sites in dissociation of the PHAS-I.eIF4E complex
12912989 TOR-signaling and RAIP motifs play distinct roles in the mammalian TOR-dependent phosphorylation of initiation factor 4E-binding protein 1
12820960 Rheb is a mediator of 4EBP1.
12759354 4EBP1 is activated by the Type I IFN receptor-activated PI 3'-kinase pathway and has a role in regulating mRNA translation and induction of Type I IFN responses
12618431 data demonstrates that eukaryotic translation initiation factor 4E binding protein 1 is a new target for early growth response-1
12604610 raptor binds to p70S6k and 4E-BP1 through their respective TOS (conserved TOR signaling) motifs.
12588975 4E-binding protein 1 C terminus has domains that control function and phosphorylation
12271141 hamartin and tuberin function together to inhibit mammalian target of rapamycin (mTOR)-mediated signaling to eukaryotic initiation factor 4E-binding protein 1 (4E-BP1) and ribosomal protein S6 kinase 1 (S6K1)
12080086 Mammalian cell size is controlled by mTOR and its downstream targets S6K1 and 4EBP1/eIF4E
11909977 Translational control of cell fate: availability of phosphorylation sites on translational repressor 4E-BP1 governs its proapoptotic potency.
11847216 4E-binding proteins, the suppressors of eukaryotic initiation factor 4E, are down-regulated in cells with acquired or intrinsic resistance to rapamycin.

AA Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKT      1 - 70
PPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI                           71 - 118
//

Text Mined References (198)

PMID Year Title
26832959 2016 Stabilization of p21 by mTORC1/4E-BP1 predicts clinical outcome of head and neck cancers.
26577921 2015 Cell type-specific abundance of 4EBP1 primes prostate cancer sensitivity or resistance to PI3K pathway inhibitors.
26427479 2016 The mTOR Kinase Inhibitor INK128 Blunts Migration of Cultured Retinal Pigment Epithelial Cells.
26360779 2015 Twist1-mediated 4E-BP1 regulation through mTOR in non-small cell lung cancer.
26305094 2015 4EBP1 Is Dephosphorylated by Respiratory Syncytial Virus Infection.
26204490 2015 eIF4E binding protein 1 expression is associated with clinical survival outcomes in colorectal cancer.
26170285 2015 Molecular mechanism of the dual activity of 4EGI-1: Dissociating eIF4G from eIF4E but stabilizing the binding of unphosphorylated 4E-BP1.
26097581 2015 Prognostic significance of phosphorylated 4E-binding protein 1 in non-small cell lung cancer.
25999352 2015 RPPA-based protein profiling reveals eIF4G overexpression and 4E-BP1 serine 65 phosphorylation as molecular events that correspond with a pro-survival phenotype in chronic lymphocytic leukemia.
25883264 2015 CDK1 substitutes for mTOR kinase to activate mitotic cap-dependent protein translation.
25762619 2015 Both mTORC1 and mTORC2 are involved in the regulation of cell adhesion.
25755728 2015 Expression of eukaryotic initiation factor 4E and 4E binding protein 1 in colorectal carcinogenesis.
25702871 2015 Molecular architecture of 4E-BP translational inhibitors bound to eIF4E.
25659153 2015 Tanshinone IIA inhibits HIF-1? and VEGF expression in breast cancer cells via mTOR/p70S6K/RPS6/4E-BP1 signaling pathway.
25618298 2015 Significance of 4E-binding protein 1 as a therapeutic target for invasive urothelial carcinoma of the bladder.
25503819 2015 Effect of temperature on the conformation of natively unfolded protein 4E-BP1 in aqueous and mixed solutions containing trifluoroethanol and hexafluoroisopropanol.
25482447 2015 Parthenolide induces autophagy via the depletion of 4E-BP1.
25466966 2015 Comparison of Akt/mTOR/4E-BP1 pathway signal activation and mutations of PIK3CA in Merkel cell polyomavirus-positive and Merkel cell polyomavirus-negative carcinomas.
25439783 2015 The 4E-BP1/eIF4E ratio is a determinant for rapamycin response in esophageal cancer cells.
25431930 2015 A pre-structured helix in the intrinsically disordered 4EBP1.
25416956 2014 A proteome-scale map of the human interactome network.
25165983 2014 Activation of Akt/mTOR pathway is associated with poor prognosis of nasopharyngeal carcinoma.
25114899 2014 Sensitization of cancer cells through reduction of total Akt and downregulation of salinomycin-induced pAkt, pGSk3?, pTSC2, and p4EBP1 by cotreatment with MK-2206.
24837366 2015 The ShcA adaptor activates AKT signaling to potentiate breast tumor angiogenesis by stimulating VEGF mRNA translation in a 4E-BP-dependent manner.
24780446 2014 Salvianolic acid B protects human endothelial progenitor cells against oxidative stress-mediated dysfunction by modulating Akt/mTOR/4EBP1, p38 MAPK/ATF2, and ERK1/2 signaling pathways.
24706262 2014 Overexpression of phosphorylated 4E-binding protein 1 predicts lymph node metastasis and poor prognosis of Chinese patients with hilar cholangiocarcinoma.
24515783 2014 TBC1D7 mutations are associated with intellectual disability, macrocrania, patellar dislocation, and celiac disease.
24466059 2014 eRF3b, a biomarker for hepatocellular carcinoma, influences cell cycle and phosphoralation status of 4E-BP1.
24401275 2014 MNK1 pathway activity maintains protein synthesis in rapalog-treated gliomas.
24354477 2014 4E-BP1 regulates the sensitivity of human glioma cells to chemotherapy through PI3K/Akt/mTOR-independent pathway.
24307346 2014 Expression level of phosphorylated-4E-binding protein 1 in radical nephrectomy specimens as a prognostic predictor in patients with metastatic renal cell carcinoma treated with mammalian target of rapamycin inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211447 2013 Eukaryotic translation initiation is controlled by cooperativity effects within ternary complexes of 4E-BP1, eIF4E, and the mRNA 5' cap.
24206664 2013 mTORC1 controls mitochondrial activity and biogenesis through 4E-BP-dependent translational regulation.
24131622 2013 The mTOR effectors 4EBP1 and S6K2 are frequently coexpressed, and associated with a poor prognosis and endocrine resistance in breast cancer: a retrospective study including patients from the randomised Stockholm tamoxifen trials.
24122746 2014 Limited proteolysis of natively unfolded protein 4E-BP1 in the presence of trifluoroethanol.
24030155 2013 Overexpression of 4EBP1, p70S6K, Akt1 or Akt2 differentially promotes Coxsackievirus B3-induced apoptosis in HeLa cells.
23814182 2013 Tracking a refined eIF4E-binding motif reveals Angel1 as a new partner of eIF4E.
23814053 2013 Protein phosphatase PPM1G regulates protein translation and cell growth by dephosphorylating 4E binding protein 1 (4E-BP1).
23707523 2013 Mammalian target of rapamycin-independent S6K1 and 4E-BP1 phosphorylation during contraction in rat skeletal muscle.
23640516 2013 Aerosol delivery of eukaryotic translation initiation factor 4E-binding protein 1 effectively suppresses lung tumorigenesis in K-rasLA1 mice.
23547259 2013 Inactivation of the mTORC1-eukaryotic translation initiation factor 4E pathway alters stress granule formation.
23451476 2012 [Expression and correlational research of mTOR and 4EBP1 in laryngeal carcinoma].
23340172 2013 Phosphorylation of 4E-BP1 predicts sensitivity to everolimus in gastric cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23175522 2013 Contribution of HIF-1? in 4E-BP1 gene expression.
23100465 2012 eIF4E/4E-BP ratio predicts the efficacy of mTOR targeted therapies.
23082216 2012 Phosphorylation of 4E-BP1 in the mammalian brain is not altered by LRRK2 expression or pathogenic mutations.
22977662 2012 Expression of phosphorylated mTOR and its regulatory protein is related to biological behaviors of ameloblastoma.
22918237 2012 4E-BP1 participates in maintaining spindle integrity and genomic stability via interacting with PLK1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22690797 2012 Phosphorylated 4E-binding protein 1 (p-4E-BP1): a novel prognostic marker in human astrocytomas.
22652449 2012 Nanosecond pulsed electric fields act as a novel cellular stress that induces translational suppression accompanied by eIF2? phosphorylation and 4E-BP1 dephosphorylation.
22578813 2012 Translational homeostasis via the mRNA cap-binding protein, eIF4E.
22248270 2012 Immunohistochemical analysis of the mTOR pathway in intrahepatic cholangiocarcinoma.
22216185 2011 Sensitivity of global translation to mTOR inhibition in REN cells depends on the equilibrium between eIF4E and 4E-BP1.
22184107 2012 Hepatitis C virus NS5A binds to the mRNA cap-binding eukaryotic translation initiation 4F (eIF4F) complex and up-regulates host translation initiation machinery through eIF4E-binding protein 1 inactivation.
22178476 2012 Structural insights into the allosteric effects of 4EBP1 on the eukaryotic translation initiation factor eIF4E.
22142830 2011 Targeting the mTOR/4E-BP pathway in endometrial cancer.
22110663 2011 S6K1 and 4E-BP1 are independent regulated and control cellular growth in bladder cancer.
21964297 2011 Identification and function of the second eIF4E-binding region in N-terminal domain of eIF4G: comparison with eIF4E-binding protein.
21922152 2012 Association between LRRK2 and 4E-BP1 protein levels in normal and malignant cells.
21914810 2011 The mechanism of insulin-stimulated 4E-BP protein binding to mammalian target of rapamycin (mTOR) complex 1 and its contribution to mTOR complex 1 signaling.
21913890 2012 A conserved motif within the flexible C-terminus of the translational regulator 4E-BP is required for tight binding to the mRNA cap-binding protein eIF4E.
21841310 2011 Human Merkel cell polyomavirus small T antigen is an oncoprotein targeting the 4E-BP1 translation regulator.
21784851 2011 Eukaryotic translation initiation factor 4E binding protein 1 (4EBP-1) function is suppressed by Src and protein phosphatase 2A (PP2A) on extracellular matrix.
21750861 2011 The effect of p-4E-BP1 and p-eIF4E on cell proliferation in a breast cancer model.
21661078 2011 Structural scaffold for eIF4E binding selectivity of 4E-BP isoforms: crystal structure of eIF4E binding region of 4E-BP2 and its comparison with that of 4E-BP1.
21576371 2011 Relieving autophagy and 4EBP1 from rapamycin resistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21366462 2011 Expression and phosphorylation of eukaryotic translation initiation factor 4E binding protein 1 in B-cell lymphomas and reactive lymphoid tissues.
21269460 2011 Initial characterization of the human central proteome.
21067588 2010 mTOR signaling is activated by FLT3 kinase and promotes survival of FLT3-mutated acute myeloid leukemia cells.
21046149 2011 High expression of phosphorylated 4E-binding protein 1 is an adverse prognostic factor in esophageal squamous cell carcinoma.
20671708 2010 Pathogenic LRRK2 negatively regulates microRNA-mediated translational repression.
20621385 2010 Prognostic significance of expression of eukaryotic initiation factor 4E and 4E binding protein 1 in patients with pathological stage I invasive lung adenocarcinoma.
20609351 2010 4E-BP1 is a key effector of the oncogenic activation of the AKT and ERK signaling pathways that integrates their function in tumors.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20372058 2010 Control of contact-inhibition by 4E-BP1 upregulation.
20304964 2010 The NADPH oxidase subunit p22phox inhibits the function of the tumor suppressor protein tuberin.
20224576 2010 Sumoylation of eIF4E activates mRNA translation.
20133758 2010 Human cytomegalovirus UL69 protein facilitates translation by associating with the mRNA cap-binding complex and excluding 4EBP1.
20090955 2010 The Parkinson's disease associated LRRK2 exhibits weaker in vitro phosphorylation of 4E-BP compared to autophosphorylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19850923 2009 RhoE inhibits 4E-BP1 phosphorylation and eIF4E function impairing cap-dependent translation.
19834456 2009 4E-BP1 is a target of Smad4 essential for TGFbeta-mediated inhibition of cell proliferation.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648884 2009 EGFR-dependent and independent activation of Akt/mTOR cascade in bone and soft tissue tumors.
19603014 2009 Activated 4E-BP1 represses tumourigenesis and IGF-I-mediated activation of the eIF4F complex in mesothelioma.
19574449 2009 Involvement of 4E-BP1 in the protection induced by HDLs on pancreatic beta-cells.
19541645 2009 Activation of tumor cell integrin alphavbeta3 controls angiogenesis and metastatic growth in the brain.
19533653 2009 Atrogin-1, MuRF1, and FoXO, as well as phosphorylated GSK-3beta and 4E-BP1 are reduced in skeletal muscle of chronic spinal cord-injured patients.
19429661 2009 Expression of selected tumor suppressor and oncogenes in endometrium of women with endometriosis.
19428047 2009 Cell signaling in endometrial carcinoma: phosphorylated 4E-binding protein-1 expression in endometrial cancer correlates with aggressive tumors and prognosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19367274 2009 Combined analysis of eIF4E and 4E-binding protein expression predicts breast cancer survival and estimates eIF4E activity.
19360336 2009 Adenovirus-mediated eukaryotic initiation factor 4E binding protein-1 in combination with rapamycin inhibits tumor growth of pancreatic ductal adenocarcinoma in vivo.
19336517 2009 Phosphorylated 4E-BP1 is associated with poor survival in melanoma.
19271249 2009 Extended tracts of homozygosity identify novel candidate genes associated with late-onset Alzheimer's disease.
19244480 2009 The eIF4E-binding proteins are modifiers of cytoplasmic eIF4E relocalization during the heat shock response.
19211763 2009 PI3K signaling regulates rapamycin-insensitive translation initiation complex formation in vaccinia virus-infected cells.
19107520 2009 Phospho-mTOR and phospho-4EBP1 in endometrial adenocarcinoma: association with stage and grade in vivo and link with response to rapamycin treatment in vitro.
19036825 2009 Skeletal muscle eEF2 and 4EBP1 phosphorylation during endurance exercise is dependent on intensity and muscle fiber type.
18810319 2008 Phosphatidylinositol 3-kinase-dependent transcriptional silencing of the translational repressor 4E-BP1.
18708753 2008 Effects of 4E-BP1 expression on hypoxic cell cycle inhibition and tumor cell proliferation and survival.
18701920 2008 Phosphorylation of 4E-BP by LRRK2 affects the maintenance of dopaminergic neurons in Drosophila.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18668138 2009 Akt1 controls insulin-driven VEGF biosynthesis from keratinocytes: implications for normal and diabetes-impaired skin repair in mice.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18442140 2008 Associations between multiple system atrophy and polymorphisms of SLC1A4, SQSTM1, and EIF4EBP1 genes.
18439897 2008 The splicing factor SF2/ASF regulates translation initiation by enhancing phosphorylation of 4E-BP1.
18384376 2008 Analysis of the regulatory motifs in eukaryotic initiation factor 4E-binding protein 1.
18337751 2008 cdc2-cyclin B regulates eEF2 kinase activity in a cell cycle- and amino acid-dependent manner.
18337562 2008 CCL5-mediated T-cell chemotaxis involves the initiation of mRNA translation through mTOR/4E-BP1.
18280804 2008 Role of the translational repressor 4E-BP1 in the regulation of p21(Waf1/Cip1) expression by retinoids.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17724476 2008 Regulation of cyclin D1 expression by mTORC1 signaling requires eukaryotic initiation factor 4E-binding protein 1.
17699757 2007 4E-binding protein 1: a key molecular "funnel factor" in human cancer with clinical implications.
17653084 2008 Effects of protein phosphorylation on ubiquitination and stability of the translational inhibitor protein 4E-BP1.
17631896 2007 Crystallographic and mass spectrometric characterisation of eIF4E with N7-alkylated cap derivatives.
17604271 2007 PRAS40 is a target for mammalian target of rapamycin complex 1 and is required for signaling downstream of this complex.
17601486 2007 Perillyl alcohol and genistein differentially regulate PKB/Akt and 4E-BP1 phosphorylation as well as eIF4E/eIF4G interactions in human tumor cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17368478 2007 Structures of the human eIF4E homologous protein, h4EHP, in its m7GTP-bound and unliganded forms.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17316564 2007 Binding preference of eIF4E for 4E-binding protein isoform and function of eIF4E N-terminal flexible region for interaction, studied by SPR analysis.
17200342 2007 4E-binding protein 1, a cell signaling hallmark in breast cancer that correlates with pathologic grade and prognosis.
17114181 2007 Regulatory effects of mammalian target of rapamycin-activated pathways in type I and II interferon signaling.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16983702 2006 Phosphorylated 4E binding protein 1: a hallmark of cell signaling that correlates with survival in ovarian cancer.
16873412 2006 Resistance exercise increases AMPK activity and reduces 4E-BP1 phosphorylation and protein synthesis in human skeletal muscle.
16824195 2006 Different roles for the TOS and RAIP motifs of the translational regulator protein 4E-BP1 in the association with raptor and phosphorylation by mTOR in the regulation of cell size.
16715128 2006 Rapamycin inhibits cell motility by suppression of mTOR-mediated S6K1 and 4E-BP1 pathways.
16652388 2006 Expression of mTOR signaling pathway markers in prostate cancer progression.
16648488 2006 Hypoxia inhibits protein synthesis through a 4E-BP1 and elongation factor 2 kinase pathway controlled by mTOR and uncoupled in breast cancer cells.
16504179 2006 Regulation of protein synthesis by inducible wild-type p53 in human lung carcinoma cells.
16271312 2005 Structural basis for mRNA Cap-Binding regulation of eukaryotic initiation factor 4E by 4E-binding protein, studied by spectroscopic, X-ray crystal structural, and molecular dynamics simulation methods.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16098202 2005 Levels of mTOR and its downstream targets 4E-BP1, eEF2, and eEF2 kinase in relationships with tau in Alzheimer's disease brain.
15809305 2005 Structure of S6 kinase 1 determines whether raptor-mTOR or rictor-mTOR phosphorylates its hydrophobic motif site.
15542544 2005 Hyperoxia alters the expression and phosphorylation of multiple factors regulating translation initiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15178440 2004 eIF4E binding protein 1 and H-Ras are novel substrates for the protein kinase activity of class-I phosphoinositide 3-kinase.
15153109 2004 Characterization of mammalian eIF4E-family members.
15094042 2004 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673156 2004 mTOR controls cell cycle progression through its cell growth effectors S6K1 and 4E-BP1/eukaryotic translation initiation factor 4E.
14507920 2003 Ser-64 and Ser-111 in PHAS-I are dispensable for insulin-stimulated dissociation from eIF4E.
12912989 2003 Target of rapamycin (TOR)-signaling and RAIP motifs play distinct roles in the mammalian TOR-dependent phosphorylation of initiation factor 4E-binding protein 1.
12820960 2003 Insulin activation of Rheb, a mediator of mTOR/S6K/4E-BP signaling, is inhibited by TSC1 and 2.
12759354 2003 Activation of the p70 S6 kinase and phosphorylation of the 4E-BP1 repressor of mRNA translation by type I interferons.
12747827 2003 TOS motif-mediated raptor binding regulates 4E-BP1 multisite phosphorylation and function.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12665511 2003 Two motifs in the translational repressor PHAS-I required for efficient phosphorylation by mammalian target of rapamycin and for recognition by raptor.
12618431 2003 ERK and p38 inhibit the expression of 4E-BP1 repressor of translation through induction of Egr-1.
12604610 2003 The mammalian target of rapamycin (mTOR) partner, raptor, binds the mTOR substrates p70 S6 kinase and 4E-BP1 through their TOR signaling (TOS) motif.
12588975 2003 The C terminus of initiation factor 4E-binding protein 1 contains multiple regulatory features that influence its function and phosphorylation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271141 2002 Tuberous sclerosis complex-1 and -2 gene products function together to inhibit mammalian target of rapamycin (mTOR)-mediated downstream signaling.
12151318 2002 Oxidant-induced hypertrophy of A549 cells is accompanied by alterations in eukaryotic translation initiation factor 4E and 4E-binding protein-1.
12150926 2002 Raptor, a binding partner of target of rapamycin (TOR), mediates TOR action.
12150925 2002 mTOR interacts with raptor to form a nutrient-sensitive complex that signals to the cell growth machinery.
12105188 2002 Integrin (alpha 6 beta 4) regulation of eIF-4E activity and VEGF translation: a survival mechanism for carcinoma cells.
12080086 2002 Mammalian cell size is controlled by mTOR and its downstream targets S6K1 and 4EBP1/eIF4E.
11865047 2002 Caspase cleavage of initiation factor 4E-binding protein 1 yields a dominant inhibitor of cap-dependent translation and reveals a novel regulatory motif.
11847216 2002 4E-binding proteins, the suppressors of eukaryotic initiation factor 4E, are down-regulated in cells with acquired or intrinsic resistance to rapamycin.
11777913 2002 Phosphorylation of 4E-BP1 is mediated by the p38/MSK1 pathway in response to UVB irradiation.
11691836 2001 Hierarchical phosphorylation of the translation inhibitor 4E-BP1.
11605658 2001 Structural and thermodynamic behavior of eukaryotic initiation factor 4E in supramolecular formation with 4E-binding protein 1 and mRNA cap analogue, studied by spectroscopic methods.
11553333 2001 Cell cycle-dependent phosphorylation of the translational repressor eIF-4E binding protein-1 (4E-BP1).
11438723 2001 Visualization of biochemical networks in living cells.
11280764 2001 Molecular basis of T cell-mediated recognition of pancreatic cancer cells.
11146653 2000 Participation of ATM in insulin signalling through phosphorylation of eIF-4E-binding protein 1.
11114166 2000 Cytoplasmic-nuclear shuttling of FKBP12-rapamycin-associated protein is involved in rapamycin-sensitive signaling and translation initiation.
11069026 2000 Defect in the regulation of 4E-BP1 and 2, two repressors of translation initiation, in the retinoid acid resistant cell lines, NB4-R1 and NB4-R2.
10942774 2000 Mammalian target of rapamycin-dependent phosphorylation of PHAS-I in four (S/T)P sites detected by phospho-specific antibodies.
10779345 2000 Multiple mechanisms control phosphorylation of PHAS-I in five (S/T)P sites that govern translational repression.
10772338 2000 Regulation of human eIF4E by 4E-BP1: binding analysis using surface plasmon resonance.
10405182 1999 Mutational analysis of sites in the translational regulator, PHAS-I, that are selectively phosphorylated by mTOR.
10364159 1999 Regulation of 4E-BP1 phosphorylation: a novel two-step mechanism.
10198256 1999 Phosphorylation of human MAD1 by the BUB1 kinase in vitro.
10092805 1999 Differential regulation of 4E-BP1 and 4E-BP2, two repressors of translation initiation, during human myeloid cell differentiation.
9806882 1998 Insulin-stimulated kinase from rat fat cells that phosphorylates initiation factor 4E-binding protein 1 on the rapamycin-insensitive site (serine-111).
9684899 1998 The interaction of eIF4E with 4E-BP1 is an induced fit to a completely disordered protein.
9628874 1998 PRAK, a novel protein kinase regulated by the p38 MAP kinase.
9465032 1998 RAFT1 phosphorylation of the translational regulators p70 S6 kinase and 4E-BP1.
9405468 1997 The mammalian target of rapamycin phosphorylates sites having a (Ser/Thr)-Pro motif and is activated by antibodies to a region near its COOH terminus.
9344920 1997 Adenovirus infection inactivates the translational inhibitors 4E-BP1 and 4E-BP2.
9092573 1997 Identification of phosphorylation sites in the translational regulator, PHAS-I, that are controlled by insulin and rapamycin in rat adipocytes.
8975712 1996 Tissue distribution, genomic structure, and chromosome mapping of mouse and human eukaryotic initiation factor 4E-binding proteins 1 and 2.
8957083 1996 The eIF4E-binding proteins 1 and 2 are negative regulators of cell growth.
8816458 1996 Cap-binding protein (eukaryotic initiation factor 4E) and 4E-inactivating protein BP-1 independently regulate cap-dependent translation.
8521827 1995 Repression of cap-dependent translation by 4E-binding protein 1: competition with p220 for binding to eukaryotic initiation factor-4E.
8083223 1994 Phosphorylation of PHAS-I by mitogen-activated protein (MAP) kinase. Identification of a site phosphorylated by MAP kinase in vitro and in response to insulin in rat adipocytes.
7935836 1994 Insulin-dependent stimulation of protein synthesis by phosphorylation of a regulator of 5'-cap function.
7651417 1995 The translation initiation factor eIF-4E binds to a common motif shared by the translation factor eIF-4 gamma and the translational repressors 4E-binding proteins.