Property Summary

NCBI Gene PubMed Count 198
PubMed Score 578.92
PubTator Score 371.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.057 2.3e-03
adult high grade glioma 1.700 9.6e-06
Astrocytoma, Pilocytic 1.600 1.6e-07
atypical teratoid / rhabdoid tumor 1.700 8.7e-06
colon cancer 1.100 3.6e-02
glioblastoma 2.200 1.0e-09
group 3 medulloblastoma 1.900 3.2e-04
intraductal papillary-mucinous adenoma (... -1.500 1.1e-02
lung adenocarcinoma 2.000 1.3e-14
lung cancer 1.300 1.4e-03
medulloblastoma, large-cell 2.900 1.3e-06
non-small cell lung cancer 1.884 5.3e-20
pancreatic cancer -1.900 1.8e-03
posterior fossa group A ependymoma 1.300 6.0e-08
primary pancreatic ductal adenocarcinoma -2.075 9.6e-04
primitive neuroectodermal tumor 1.900 2.0e-04
psoriasis 1.200 7.0e-44

Protein-protein Interaction (6)

PDB (17)

Gene RIF (143)

AA Sequence

MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKT      1 - 70
PPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI                           71 - 118
//

Text Mined References (214)

PMID Year Title