Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.46
PubTator Score 6.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.600 2.9e-02
astrocytic glioma -2.000 6.8e-03
ependymoma -1.700 4.5e-02
oligodendroglioma -1.500 2.2e-17
glioblastoma -1.900 3.9e-07
osteosarcoma -2.300 1.9e-05
sonic hedgehog group medulloblastoma -1.700 3.9e-05
atypical teratoid / rhabdoid tumor -1.600 2.5e-04
medulloblastoma, large-cell -1.400 2.4e-03
primitive neuroectodermal tumor -1.600 3.0e-03
hereditary spastic paraplegia -1.264 9.4e-03
tuberculosis 1.800 3.7e-08
non-small cell lung cancer -1.419 1.6e-18
adult high grade glioma -2.200 5.3e-07
pilocytic astrocytoma -1.700 2.7e-08
pancreatic carcinoma -1.600 2.9e-02
Breast cancer -1.700 9.3e-11
ductal carcinoma in situ -1.300 2.4e-04
invasive ductal carcinoma -1.800 8.8e-04
ovarian cancer -1.500 3.0e-04

Protein-protein Interaction (2)

Gene RIF (3)

PMID Text
25403230 MNK1 and MNK2 inhibition ablates eIF4E1 phosphorylation and concurrently enhances eIF4E3 expression in diffuse large B-cell lymphoma.
23587918 eIF4E3 impedes oncogenic transformation and its expression is lost in some cancers.
23333304 HIV-1 Vif upregulates the expression of eukaryotic translation initiation factor 4E family member 3 (EIF4E3) in Vif-expression T cells

AA Sequence

MALPPAAAPPAGAREPPGSRAAAAAAAPEPPLGLQQLSALQPEPGGVPLHSSWTFWLDRSLPGATAAECA      1 - 70
SNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWK     71 - 140
ELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKP    141 - 210
HEEHHAFEGGRGKH                                                            211 - 224
//

Text Mined References (9)

PMID Year Title
25403230 2014 MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL.
23587918 2013 eIF4E3, a new actor in mRNA metabolism and tumor suppression.
23431134 2013 eIF4E3 acts as a tumor suppressor by utilizing an atypical mode of methyl-7-guanosine cap recognition.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15153109 2004 Characterization of mammalian eIF4E-family members.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.