Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.74
PubTator Score 1.50

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.3e-03


  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 4.3e-03

AA Sequence

RLGLSPKTIIGYQAHADTATKSNSLAKNKFVV                                          211 - 242

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16191198 2005 Phylogenetic analysis of eIF4E-family members.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.