Property Summary

NCBI Gene PubMed Count 30
PubMed Score 179.34
PubTator Score 104.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 8.4e-05
glioblastoma -1.200 7.0e-04
Multiple myeloma 1.233 1.9e-03
ovarian cancer -1.200 2.1e-03
subependymal giant cell astrocytoma -1.239 5.4e-03
Waldenstrons macroglobulinemia 1.043 1.1e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG      1 - 70
YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN     71 - 140
VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV    141 - 210
VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL    211 - 280
NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL    281 - 350
PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI                 351 - 407
//

Text Mined References (37)

PMID Year Title